BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B02f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 95 3e-20 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 89 1e-18 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 89 2e-18 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 89 2e-18 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 82 2e-16 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 79 2e-15 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 79 2e-15 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 75 2e-14 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 69 2e-12 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 69 3e-12 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 68 3e-12 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 67 6e-12 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 67 8e-12 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 64 7e-11 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 63 1e-10 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 63 1e-10 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 60 9e-10 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 59 2e-09 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 59 2e-09 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 58 4e-09 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 57 8e-09 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 56 1e-08 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 56 1e-08 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 56 1e-08 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 56 1e-08 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 56 2e-08 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 52 2e-07 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 51 5e-07 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 51 5e-07 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 50 7e-07 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 50 7e-07 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 50 9e-07 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 50 1e-06 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 48 5e-06 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 47 7e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 47 7e-06 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 45 3e-05 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 44 5e-05 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 44 5e-05 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 44 5e-05 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 44 5e-05 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 43 1e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 40 0.001 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.001 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 39 0.002 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 39 0.002 At3g03860.1 68416.m00398 expressed protein 39 0.002 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 38 0.003 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 38 0.005 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 37 0.007 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 37 0.007 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 36 0.017 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 36 0.022 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 36 0.022 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 36 0.022 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 36 0.022 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 35 0.029 At5g40370.1 68418.m04897 glutaredoxin, putative similar to gluta... 33 0.088 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 33 0.088 At5g18120.1 68418.m02127 expressed protein 33 0.15 At3g04780.1 68416.m00515 expressed protein 33 0.15 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 31 0.36 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 31 0.47 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.62 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 30 1.1 At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, ... 29 1.4 At4g40020.1 68417.m05666 hypothetical protein 29 2.5 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 28 3.3 At5g63030.1 68418.m07907 glutaredoxin, putative similar to gluta... 27 7.7 At3g05675.2 68416.m00633 expressed protein 27 7.7 At3g05675.1 68416.m00632 expressed protein 27 7.7 At1g49700.1 68414.m05572 expressed protein ; expression supporte... 27 7.7 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 27 7.7 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 27 7.7 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 27 7.7 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 95.1 bits (226), Expect = 3e-20 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 1/100 (1%) Frame = +1 Query: 103 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQG 279 Q + A KL+V+DFTA+WCPPC+ IAP F L KF A+F KVDVD A G Sbjct: 20 QLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFG 79 Query: 280 VSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVA 399 V AMPTF+F + +D+L G N L+ K+ ++ G A Sbjct: 80 VEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTGVTTA 119 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 89.4 bits (212), Expect = 1e-18 Identities = 40/91 (43%), Positives = 54/91 (59%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 294 AN KL+V+DFTA+WCPPC+ IAP F ++ KF VF K+DVD A V AMP Sbjct: 23 ANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMP 82 Query: 295 TFIFYRNRTKIDRLEGGNTTVLENKVRQYYG 387 TF+F + IDR+ G + K+ ++ G Sbjct: 83 TFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 88.6 bits (210), Expect = 2e-18 Identities = 40/93 (43%), Positives = 55/93 (59%) Frame = +1 Query: 103 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGV 282 Q + AN LVVVDFTA+WC PC+ IAPFF L K P +FLKVD D AS + Sbjct: 20 QLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAI 79 Query: 283 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 381 AMPTF+F + +D++ G L++ + ++ Sbjct: 80 QAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 88.6 bits (210), Expect = 2e-18 Identities = 36/96 (37%), Positives = 63/96 (65%) Frame = +1 Query: 103 QTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGV 282 +T+ A ++L+++ FTATWC PC+ ++P + L + R VFLKVD+D+ D A++ + Sbjct: 284 KTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDIDKANDVAASWNI 343 Query: 283 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGS 390 S++PTF F R+ ++D++ G + LE K+ Q+ S Sbjct: 344 SSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSSS 379 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 82.2 bits (194), Expect = 2e-16 Identities = 38/86 (44%), Positives = 54/86 (62%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 294 A+ K+VV +F+ATWC PC+ +APFF +L K +FL VDVD +D +S+ + A P Sbjct: 41 ADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATP 100 Query: 295 TFIFYRNRTKIDRLEGGNTTVLENKV 372 TF F +N +I +L G N L+ KV Sbjct: 101 TFFFLKNGQQIGKLVGANKPELQKKV 126 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 78.6 bits (185), Expect = 2e-15 Identities = 37/66 (56%), Positives = 41/66 (62%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 294 AN KL+V+DFTATWCPPC+ IAP F L K VF KVDVD A V AMP Sbjct: 23 ANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMP 82 Query: 295 TFIFYR 312 TFIF + Sbjct: 83 TFIFMK 88 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 78.6 bits (185), Expect = 2e-15 Identities = 33/84 (39%), Positives = 49/84 (58%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 309 KL+V+DFTA WC PC+ + P ++ +K+ AVF +VDVDR D A +P F+F Sbjct: 44 KLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFV 103 Query: 310 RNRTKIDRLEGGNTTVLENKVRQY 381 + +IDR+ G L K+ Q+ Sbjct: 104 KRGEEIDRVVGAKPDELVKKIEQH 127 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 75.4 bits (177), Expect = 2e-14 Identities = 35/81 (43%), Positives = 48/81 (59%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 309 KL+VVDF+A+WC PC+ I P + KF F+K+DVD D A V+AMPTF+ Sbjct: 48 KLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLV 107 Query: 310 RNRTKIDRLEGGNTTVLENKV 372 + +I+R+ G LE KV Sbjct: 108 KRGKEIERIIGAKKDELEKKV 128 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 68.9 bits (161), Expect = 2e-12 Identities = 28/85 (32%), Positives = 53/85 (62%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 294 AN+ K++VV+F A+WC P + I P +++L + + +F+ +DV+ A+ + V A P Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMIFVTIDVEELAEFSHEWNVDATP 117 Query: 295 TFIFYRNRTKIDRLEGGNTTVLENK 369 T +F ++ ++D+L GG+ L+ K Sbjct: 118 TVVFLKDGRQMDKLVGGDAAELQKK 142 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 68.5 bits (160), Expect = 3e-12 Identities = 31/90 (34%), Positives = 52/90 (57%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 315 VV+ F A+WC +++ F L FPRA F +V+ + + + A V+A+P F+F+++ Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEISEAYSVAAVPYFVFFKD 83 Query: 316 RTKIDRLEGGNTTVLENKVRQYYGSDVAEE 405 +D LEG + + L NKV + GS + E Sbjct: 84 GKTVDTLEGADPSSLANKVGKVAGSSTSAE 113 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.1 bits (159), Expect = 3e-12 Identities = 29/84 (34%), Positives = 47/84 (55%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFY 309 KL+V++FTA WC PC+ + P E+L AK+ F+K+DVD +S +P +F Sbjct: 60 KLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVDVLMSVWMEFNLSTLPAIVFM 119 Query: 310 RNRTKIDRLEGGNTTVLENKVRQY 381 + ++D + G LE K+ +Y Sbjct: 120 KRGREVDMVVGVKVDELERKLNKY 143 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 67.3 bits (157), Expect = 6e-12 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 315 +V FTA WC P + FFE+L + A+FL VDVD + AS V AMPTF+F ++ Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEVASQLEVKAMPTFLFLKD 86 Query: 316 RTKIDRLEGGNTTVLENKV 372 +D+L G N ++ +V Sbjct: 87 GNAMDKLVGANPDEIKKRV 105 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 66.9 bits (156), Expect = 8e-12 Identities = 30/85 (35%), Positives = 50/85 (58%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMP 294 AN G K + A WC PC++I P F L +++P +F+ VDV+ A+ ++ V A P Sbjct: 6 ANTGPKERSI--RAPWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEATP 63 Query: 295 TFIFYRNRTKIDRLEGGNTTVLENK 369 T +F ++ ++D+L G T+ L+ K Sbjct: 64 TVVFLKDGRQMDKLVGAETSELQKK 88 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 63.7 bits (148), Expect = 7e-11 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 4/106 (3%) Frame = +1 Query: 79 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDR 252 +++++ F M+ A G+ V FTA WC PC+ I+P +L ++P KVD+D Sbjct: 88 LVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDE 147 Query: 253 --CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYY 384 ++T S ++A+PT F++ +K + G + T L+N + Q Y Sbjct: 148 GGISNTISKLNITAVPTLHFFKGGSKKGEVVGADVTKLKNLMEQLY 193 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/85 (32%), Positives = 49/85 (57%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRN 315 +V+ F A+WC +++ F L FPRA F +V+ + + + A V+ +P F+F+++ Sbjct: 24 LVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEISEAYSVALVPYFVFFKD 83 Query: 316 RTKIDRLEGGNTTVLENKVRQYYGS 390 +D LEG + + L NKV + GS Sbjct: 84 GKTVDTLEGADPSSLANKVGKVAGS 108 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/83 (33%), Positives = 47/83 (56%) Frame = +1 Query: 139 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNR 318 V+ F+ C++I+PF + L ++P FLKVD+D+C +A+ V +PT Y+N Sbjct: 617 VIHFSTASDHQCKQISPFVDSLCTRYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNG 676 Query: 319 TKIDRLEGGNTTVLENKVRQYYG 387 +++ + + VLE VR Y G Sbjct: 677 SRVKEIVCPSKEVLEYSVRHYSG 699 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 60.1 bits (139), Expect = 9e-10 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 4/106 (3%) Frame = +1 Query: 79 VIQNDAHFQTEMANA--GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDR 252 V++++A F + ++ A G+ V FTA WC PC+ I+P +L K+P KVD+D Sbjct: 53 VLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDE 112 Query: 253 --CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYY 384 ++ VSA+PT F++ K + G + L++ + Q Y Sbjct: 113 GGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQLY 158 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 59.3 bits (137), Expect = 2e-09 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 2/104 (1%) Frame = +1 Query: 67 GLATVIQNDAHFQTEMAN--AGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 240 G + ND F T + + + V+++ A+WC C +I P F +L F + F+ Sbjct: 21 GNVKIAPNDQSFLTILDDIKSSKSPAVINYGASWCGVCSQILPAFRKLSNSFSKLKFVYA 80 Query: 241 DVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKV 372 D+D C +T + + PTF FYR+ K+D + G L +++ Sbjct: 81 DIDECPET--TRHIRYTPTFQFYRDGEKVDEMFGAGEQRLHDRL 122 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 58.8 bits (136), Expect = 2e-09 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%) Frame = +1 Query: 61 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 240 T+G T + D + A AG K+VV+D WC PC+ IAP +++L K+ VFLK+ Sbjct: 76 TVGQVTEVDKDTFWPIVKA-AGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKL 134 Query: 241 DVDR-CADTASAQGVSAMPTFIFYRNRTKIDRLEG 342 D ++ A G+ +PTF ++ + + G Sbjct: 135 DCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTG 169 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 58.0 bits (134), Expect = 4e-09 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 88 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADT 264 +D+ +QT++ + V+V+F A WC PC+ I P +QL F + F K++ D +T Sbjct: 92 SDSEWQTKVLESDVP-VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNT 150 Query: 265 ASAQGVSAMPTFIFYRNRTKIDRLEG 342 A+ G+ ++PT I ++ K D + G Sbjct: 151 ANRYGIRSVPTVIIFKGGEKKDSIIG 176 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 56.8 bits (131), Expect = 8e-09 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 100 FQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQ 276 F+ + N+ K V+VD+ ATWC PCQ + P ++ + +K+D ++ A+ Sbjct: 73 FEDLLVNSD-KPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKY 131 Query: 277 GVSAMPTFIFYRNRTKIDRLEGGNT 351 + A+PTFI +++ DR EG T Sbjct: 132 KIEALPTFILFKDGEPCDRFEGALT 156 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/77 (33%), Positives = 40/77 (51%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 261 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV+ D Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVNFDENKP 167 Query: 262 TASAQGVSAMPTFIFYR 312 + V +P F FYR Sbjct: 168 MCKSLNVRVLPFFHFYR 184 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 56.4 bits (130), Expect = 1e-08 Identities = 26/77 (33%), Positives = 40/77 (51%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 261 I + F + ++ AG +LV+V+F TWC C+ + P + + P VFLKV+ D Sbjct: 108 IHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVNFDENKP 167 Query: 262 TASAQGVSAMPTFIFYR 312 + V +P F FYR Sbjct: 168 MCKSLNVRVLPFFHFYR 184 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 56.0 bits (129), Expect = 1e-08 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 1/95 (1%) Frame = +1 Query: 61 TMGLATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV 240 ++G T + D + A AG KLVV+D WC PC+ IAP ++ L K+ VFLK+ Sbjct: 66 SVGQVTEVDKDTFWPIVKA-AGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKL 124 Query: 241 DVD-RCADTASAQGVSAMPTFIFYRNRTKIDRLEG 342 D + A G+ +PTF ++ + + G Sbjct: 125 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTG 159 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 56.0 bits (129), Expect = 1e-08 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQGVSAMPTFIF 306 K V+VDF ATWC PCQ + P ++ + +K+D ++ A+ + A+PTFI Sbjct: 77 KPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEALPTFIL 136 Query: 307 YRNRTKIDRLEG 342 +++ DR EG Sbjct: 137 FKDGKLWDRFEG 148 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 55.6 bits (128), Expect = 2e-08 Identities = 26/77 (33%), Positives = 39/77 (50%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 261 I + F + +AG +LV+VDF TWC C+ + P + + P +FLKV+ D Sbjct: 98 ITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVNFDENKS 157 Query: 262 TASAQGVSAMPTFIFYR 312 + V +P F FYR Sbjct: 158 LCKSLNVKVLPYFHFYR 174 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 52.0 bits (119), Expect = 2e-07 Identities = 27/77 (35%), Positives = 38/77 (49%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCAD 261 IQ+ H + NAG +LVV+DF + C C+ + P QL P +FLKV+ + Sbjct: 90 IQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAETNPNVMFLKVNQEELRT 149 Query: 262 TASAQGVSAMPTFIFYR 312 V +P F FYR Sbjct: 150 MCHGLNVHVLPFFKFYR 166 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 50.8 bits (116), Expect = 5e-07 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 5/111 (4%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRA---VFLKVDVD 249 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + KVD D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 250 RCADTASAQGVSAMPTFIFY-RNRTKIDRLEG-GNTTVLENKVRQYYGSDV 396 + GVS PT ++ + + + EG N L V + G++V Sbjct: 84 EQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNV 134 Score = 41.1 bits (92), Expect = 4e-04 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPR---AVFLKVDVDRCADTASAQGVSAMPTF 300 K V+V+F A WC C+ +AP +E++ F + V +D D GVS PT Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTL 219 Query: 301 IFYRNRTK 324 F+ K Sbjct: 220 KFFPKDNK 227 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 50.8 bits (116), Expect = 5e-07 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 5/111 (4%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRA---VFLKVDVD 249 V+ D F+ E+ K +V+F A WC C+++AP +E+L A F +A + KVD D Sbjct: 26 VVLTDDSFEKEVGK--DKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCD 83 Query: 250 RCADTASAQGVSAMPTFIFY-RNRTKIDRLEG-GNTTVLENKVRQYYGSDV 396 + GVS PT ++ + + + EG N L V + G++V Sbjct: 84 EQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNV 134 Score = 41.1 bits (92), Expect = 4e-04 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKFPR---AVFLKVDVDRCADTASAQGVSAMPTF 300 K V+V+F A WC C+ +AP +E++ F + V +D D GVS PT Sbjct: 160 KDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTL 219 Query: 301 IFYRNRTK 324 F+ K Sbjct: 220 KFFPKDNK 227 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 50.4 bits (115), Expect = 7e-07 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCA 258 + ND+ + + + A T VVVDF A WC PC+ I P L + + F K++ D Sbjct: 84 VVNDSTWDSLVLKA-TGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESP 142 Query: 259 DTASAQGVSAMPTFIFYRNRTKIDRLEG 342 +T GV ++PT + + K D + G Sbjct: 143 NTPGQYGVRSIPTIMIFVGGEKKDTIIG 170 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 50.4 bits (115), Expect = 7e-07 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCA 258 + ND+ + + + A V VDF A WC PC+ I P +L K+ + F K++ D Sbjct: 78 VVNDSTWDSLVLKADEP-VFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESP 136 Query: 259 DTASAQGVSAMPTFIFYRNRTKIDRLEG 342 T GV ++PT + + N K D + G Sbjct: 137 ATPGQYGVRSIPTIMIFVNGEKKDTIIG 164 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 50.0 bits (114), Expect = 9e-07 Identities = 22/72 (30%), Positives = 39/72 (54%) Frame = +1 Query: 166 PPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGG 345 P C+ I+ F + L ++P FLKV++ +C + +A+ V +PTF Y+ ++ + Sbjct: 648 PQCKEISTFVDALCVRYPSLHFLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMKEIVCP 707 Query: 346 NTTVLENKVRQY 381 + LE VR Y Sbjct: 708 SKEALEKTVRHY 719 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 49.6 bits (113), Expect = 1e-06 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 5/109 (4%) Frame = +1 Query: 82 IQNDAHFQTEMANAGT--KLVVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDR 252 I ++HF M +A + VV+ + A WC C + P E+L A+F PR F VDV+ Sbjct: 81 ICGESHFDQVMEDAQKLGESVVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNA 140 Query: 253 CA-DTASAQGVSAMPTFIFYRNRTKIDRLEGGNTT-VLENKVRQYYGSD 393 S GV+ MPT +R+ K + GG+ + N+VR+ +D Sbjct: 141 VPYRLVSRAGVTKMPTIQLWRDGQKQAEVIGGHKAHFVVNEVREMIEND 189 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 47.6 bits (108), Expect = 5e-06 Identities = 25/67 (37%), Positives = 34/67 (50%) Frame = +1 Query: 112 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAM 291 + NAG KLVVVDF + C C+ + P Q P FL+V+ + + GV + Sbjct: 112 LTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHKSMCYSLGVHVL 171 Query: 292 PTFIFYR 312 P F FYR Sbjct: 172 PFFRFYR 178 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 47.2 bits (107), Expect = 7e-06 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = +1 Query: 172 CQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNT 351 C+ I+PF L ++P F VDV+ A A+ + +PTF Y+N K+ + + Sbjct: 620 CEEISPFINTLCLRYPLVHFFMVDVEESMALAKAESIRKVPTFKMYKNGDKVKEMVCPSH 679 Query: 352 TVLENKVRQY 381 LE+ ++ + Sbjct: 680 QFLEDSIKHF 689 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 47.2 bits (107), Expect = 7e-06 Identities = 23/67 (34%), Positives = 35/67 (52%) Frame = +1 Query: 112 MANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAM 291 + NAG KLVVVDF + C C+ + P ++ K P FL+V+ + + + + Sbjct: 108 LRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPEVEFLQVNYEEHRSLCQSLNIHVL 167 Query: 292 PTFIFYR 312 P F FYR Sbjct: 168 PFFRFYR 174 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 45.2 bits (102), Expect = 3e-05 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 3/107 (2%) Frame = +1 Query: 82 IQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKV---DVDR 252 I + F + NA +KLVV +F + +I PF +L VFL V + D+ Sbjct: 78 IHSGEEFDVALKNAKSKLVVAEFATSKSDQSNKIYPFMVELSRTCNDVVFLLVMGDESDK 137 Query: 253 CADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 393 + + + +P F FY++ KI EG L V YYG + Sbjct: 138 TRELCRREKIEKVPHFSFYKSMEKIHEEEGIEPDQLMGDV-LYYGDN 183 Score = 37.5 bits (83), Expect = 0.005 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 4/92 (4%) Frame = +1 Query: 124 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR-AVFLKV---DVDRCADTASAQGVSAM 291 G KL+V+D C PC ++ P +L VF ++ + D C + V + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 292 PTFIFYRNRTKIDRLEGGNTTVLENKVRQYYG 387 PTF+F R+ R G L ++ +Y G Sbjct: 266 PTFLFIRDGEIRGRYVGSGKGELIGEILRYSG 297 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 44.4 bits (100), Expect = 5e-05 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQGVSAMPTFIF 306 ++VDF ATWC PC +A E L ++ A+ +KVD D + A V +PT F Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFF 154 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 44.4 bits (100), Expect = 5e-05 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 1/93 (1%) Frame = +1 Query: 106 TEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV-FLKVDVDRCADTASAQGV 282 TE+ N+ T V+V FTA WC PC+ + P ++ +++ F V+ D + Sbjct: 221 TEL-NSQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDI 279 Query: 283 SAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 381 S +PT + ++ ++ ++ G + L V++Y Sbjct: 280 SYLPTTLVFKGGEQMAKVTGADPKKLRELVKKY 312 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 44.4 bits (100), Expect = 5e-05 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 3/85 (3%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKF-PRAVFLKVDVDRCADTASAQGVSAMPTFIFYR 312 V+V+F ATWC PC+ I P E L ++ + +K+D D + V +P FI ++ Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 313 NRTKI--DRLEGGNTTVLENKVRQY 381 + ++ R EG + + K+++Y Sbjct: 150 DGKEVPGSRREG---AITKAKLKEY 171 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 44.4 bits (100), Expect = 5e-05 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 5/121 (4%) Frame = +1 Query: 76 TVIQ-NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQ---LPAKFPRAVFL-KV 240 TV++ D++F + ++ + VDF A WC C+R+ P + + AK + + + K+ Sbjct: 33 TVLELTDSNFDSAISTFDC--IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKL 90 Query: 241 DVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNT 420 + D+ + A + A PT + Y + ++ +L ++++ DVA + D+T Sbjct: 91 NADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVAVLESDST 150 Query: 421 V 423 V Sbjct: 151 V 151 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +1 Query: 175 QRIAPFFEQLPAKFPRAVFLKVDVDRCADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTT 354 + I+PF L ++P F KVDV+ A A+ + +PTF Y+ K+ + + Sbjct: 612 EAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMVCPSHQ 671 Query: 355 VLENKVRQY 381 +LE+ V + Sbjct: 672 LLEDSVTHF 680 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSAMPTF 300 K V+++F A WC CQ++AP +++ F P + K+D + V PT Sbjct: 391 KNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTI 450 Query: 301 IFYRNRTKIDRLEGGNT 351 F + EG T Sbjct: 451 YFRSASGNVVVYEGDRT 467 Score = 37.5 bits (83), Expect = 0.005 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFE----QLPAKFPRAVFLKVDVDRCA--DTASAQGVSAMPT 297 +VV+F A WC CQ++AP +E +L + P K+D A + A+ + PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 298 FIFYRNRTK 324 RN K Sbjct: 109 LKILRNGGK 117 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.001 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +1 Query: 94 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR-AVFLKVDVDRCADTAS 270 ++F++++ N+ +V+V+F A WC CQ + P +E++ + A +D D + Sbjct: 36 SNFKSKVLNSNG-VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQ 94 Query: 271 AQGVSAMPTF-IFYRNRTKID 330 GV PT +F + ID Sbjct: 95 DYGVRGFPTIKVFVPGKPPID 115 Score = 34.7 bits (76), Expect = 0.038 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +1 Query: 73 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFL-KVDVD 249 A+V N ++F E+ +L +V+F A WC C+++AP +++ V L V+ D Sbjct: 164 ASVELNSSNFD-ELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCD 222 Query: 250 RCADTASAQGVSAMPTFIFY 309 S V PT + + Sbjct: 223 AEQSIKSRFKVQGFPTILVF 242 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVDV--DRCADTASAQGVSAMPT 297 +VV+F A WC C+++AP +E+ L + P V K+D + + A+ V PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 298 FIFYRNRTK 324 +RN K Sbjct: 110 IKIFRNGGK 118 Score = 33.9 bits (74), Expect = 0.067 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +1 Query: 118 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSA 288 N+G K V+++F A WC CQ++AP +++ + V K+D V Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKG 448 Query: 289 MPTFIF 306 PT F Sbjct: 449 FPTIYF 454 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQ----LPAKFPRAVFLKVDV--DRCADTASAQGVSAMPT 297 +VV+F A WC C+++AP +E+ L + P V K+D + + A+ V PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 298 FIFYRNRTK 324 +RN K Sbjct: 110 IKIFRNGGK 118 Score = 35.1 bits (77), Expect = 0.029 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 3/81 (3%) Frame = +1 Query: 118 NAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF---PRAVFLKVDVDRCADTASAQGVSA 288 N+G K V+++F A WC CQ++AP +++ + V K+D V Sbjct: 390 NSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKG 448 Query: 289 MPTFIFYRNRTKIDRLEGGNT 351 PT F + EG T Sbjct: 449 FPTIYFKSASGNVVVYEGDRT 469 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 38.7 bits (86), Expect = 0.002 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 6/118 (5%) Frame = +1 Query: 124 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTA-SAQGVSAMPTF 300 G + V F A+WCP + + P F+ L + FP+ L V+ + + S G+ ++P+ Sbjct: 73 GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSI 132 Query: 301 IFYRNRTKIDRLEGGNTTV-LENKVRQYYGSD----VAEEDEDNTVAGHMDLITFITK 459 + N+T R G + L + G VAE + AG +LIT++ K Sbjct: 133 LMV-NQTLNARYHGRKDLISLIEFYEEATGLQPVQYVAEGEPTGLNAGDGNLITWLRK 189 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.3 bits (85), Expect = 0.003 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = +1 Query: 94 AHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTASA 273 ++F++++ N+ +V+V+F A WC C+ + P +E++ A + V +D A ++A Sbjct: 38 SNFKSKVLNSNG-VVLVEFFAPWCGHCKALTPTWEKV-ANILKGVATVAAIDADAHQSAA 95 Query: 274 Q--GVSAMPTF-IFYRNRTKID 330 Q G+ PT +F + ID Sbjct: 96 QDYGIKGFPTIKVFVPGKAPID 117 Score = 31.5 bits (68), Expect = 0.36 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Frame = +1 Query: 73 ATVIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFL-KVDVD 249 A+V N ++F ++ +L +V+F A WC C+++AP +++ V L V+ D Sbjct: 163 ASVELNASNFD-DLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCD 221 Query: 250 RCADTASAQGVSAMPTFIFY 309 S V PT + + Sbjct: 222 VEQSIMSRFKVQGFPTILVF 241 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 88 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 216 N +F + + + K VV+F A WCP C+ P +E++ F Sbjct: 41 NTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLF 83 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.1 bits (82), Expect = 0.007 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR--AVFLKVDVDR 252 V+ + +F + N + V+V+F A WC CQ +AP + + V K+D Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATE 163 Query: 253 CADTASAQGVSAMPTFIFY 309 + A V PT +F+ Sbjct: 164 ENELAQEYRVQGFPTLLFF 182 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +1 Query: 127 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 300 +K V+++ A WC CQ + P + +L AK R++ + +D + PT Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTI 517 Query: 301 IFY 309 +F+ Sbjct: 518 LFF 520 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.1 bits (82), Expect = 0.007 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR--AVFLKVDVDR 252 V+ + +F + N + V+V+F A WC CQ +AP + + V K+D Sbjct: 106 VVIKERNFTDVIEN--NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATE 163 Query: 253 CADTASAQGVSAMPTFIFY 309 + A V PT +F+ Sbjct: 164 ENELAQEYRVQGFPTLLFF 182 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +1 Query: 127 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 300 +K V+++ A WC CQ + P + +L AK R++ + +D + PT Sbjct: 459 SKDVLLEVYAPWCGHCQALEPMYNKL-AKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTI 517 Query: 301 IFY 309 +F+ Sbjct: 518 LFF 520 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 35.9 bits (79), Expect = 0.017 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 6/108 (5%) Frame = +1 Query: 139 VVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADTASAQGVSAMPT-FIF-- 306 +V+F A WC CQ + P + + A K+D D A + PT F+F Sbjct: 120 MVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVFLFVD 179 Query: 307 --YRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNTVAGHMDLI 444 R + +R + G T L+ K + +E+ + ++ L+ Sbjct: 180 GEMRKTYEGERTKDGIVTWLKKKASPSIHNITTKEEAERVLSAEPKLV 227 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +1 Query: 127 TKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAV--FLKVDVDRCADTASAQGVSAMPTF 300 +K V+++ A WC CQ P + +L K+ + + + +D ++ PT Sbjct: 455 SKDVLLEIYAPWCGHCQSFEPIYNKL-GKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTI 513 Query: 301 IFYRNRTK 324 +F+ K Sbjct: 514 LFFPGGNK 521 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 35.5 bits (78), Expect = 0.022 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 88 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 216 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 35.5 bits (78), Expect = 0.022 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 88 NDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF 216 N +F + ++ K V++F A WCP C+ P +E++ F Sbjct: 47 NATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARLF 89 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 35.5 bits (78), Expect = 0.022 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 8/103 (7%) Frame = +1 Query: 109 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF----PRAVFLKVDV----DRCADT 264 E + LVVVDF T C C+ I F +L + +FLK +V D ++ Sbjct: 114 EKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEV 173 Query: 265 ASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 393 A + A+P F FY+N ++ + ++ + +Y S+ Sbjct: 174 AERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYTSSE 216 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 35.5 bits (78), Expect = 0.022 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 8/103 (7%) Frame = +1 Query: 109 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKF----PRAVFLKVDV----DRCADT 264 E + LVVVDF T C C+ I F +L + +FLK +V D ++ Sbjct: 101 EKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEV 160 Query: 265 ASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSD 393 A + A+P F FY+N ++ + ++ + +Y S+ Sbjct: 161 AERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYTSSE 203 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 35.1 bits (77), Expect = 0.029 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +1 Query: 109 EMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP---RAVFLKVDVDRCADTASAQG 279 E A + K VV+F A WC C+ +AP ++ ++ V L VD + G Sbjct: 132 EEALSNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTKWEQELDEFG 191 Query: 280 VSAMPTFIF 306 V +P F F Sbjct: 192 VEGIPHFAF 200 >At5g40370.1 68418.m04897 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] SWISS-PROT:P55143 Length = 111 Score = 33.5 bits (73), Expect = 0.088 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +1 Query: 139 VVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVD 249 VV F+ T+CP C R+ +QL AKF +AV L + D Sbjct: 15 VVVFSKTYCPYCVRVKELLQQLGAKF-KAVELDTESD 50 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 33.5 bits (73), Expect = 0.088 Identities = 14/70 (20%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRCADTASAQGVSAMPTFIFYR 312 V+V+F +WC PC+ + +++ + + ++ D A + A+P + ++ Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 313 NRTKIDRLEG 342 N K + + G Sbjct: 147 NGEKRESIMG 156 >At5g18120.1 68418.m02127 expressed protein Length = 289 Score = 32.7 bits (71), Expect = 0.15 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 115 ANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADTA-SAQGVSAM 291 AN G + + F + CP + + P F+ L + FP L V+ + + S G+ ++ Sbjct: 66 ANHGNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQSQALPSVFSRYGIHSL 125 Query: 292 PTFIFYRNRTKI 327 P+ + K+ Sbjct: 126 PSILMVNQTMKM 137 >At3g04780.1 68416.m00515 expressed protein Length = 176 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 394 VAEEDEDNTVAGHMDLITFITKSECECLNEADDHPLAQAL 513 ++ E G +DL+ FI S ECLN++ H L AL Sbjct: 1 MSAESASQIPKGQVDLLDFIDWSGVECLNQSSSHSLPNAL 40 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAP 189 +++ND Q ++ + K + + F+A WC PCQR P Sbjct: 28 LVRNDGE-QVKVDSLLGKKIGLYFSAAWCGPCQRFTP 63 Score = 30.3 bits (65), Expect = 0.82 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 130 KLVVVDFTATWCPPCQRIAP 189 K +++ F+A WCPPC+ P Sbjct: 364 KTILMYFSAHWCPPCRAFTP 383 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 31.1 bits (67), Expect = 0.47 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 4/80 (5%) Frame = +1 Query: 124 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR----AVFLKVDVDRCADTASAQGVSAM 291 G + V+V A WC + P F + + K+D DR + AS + Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 292 PTFIFYRNRTKIDRLEGGNT 351 PT + + N T + GG++ Sbjct: 153 PTLLLFVNGTSL-TYNGGSS 171 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.62 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +1 Query: 148 FTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRC-ADTASAQGVSAMPTFIFYRNRTK 324 F A+WCP + + P F+ + + ++ A T S GV PT I N T Sbjct: 81 FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKASTLSKYGVHGFPTIIL-MNSTM 139 Query: 325 IDRLEGGNT 351 + G T Sbjct: 140 LVVYRGSRT 148 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 29.9 bits (64), Expect = 1.1 Identities = 22/108 (20%), Positives = 43/108 (39%), Gaps = 4/108 (3%) Frame = +1 Query: 124 GTKLVVVDFTATWCPPCQRIAPFFEQLPAKFPR----AVFLKVDVDRCADTASAQGVSAM 291 G + V+V A WC + P F + + K+D +R + AS + Sbjct: 91 GNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGF 150 Query: 292 PTFIFYRNRTKIDRLEGGNTTVLENKVRQYYGSDVAEEDEDNTVAGHM 435 PT + + N T G ++ + V++ G+ + D + +G + Sbjct: 151 PTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTIKLDTVDEASGFL 198 >At5g02370.1 68418.m00160 kinesin motor protein-related kinesin, Xenopus laevis, EMBL:XLA249840 Length = 628 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 240 YFEKYCSRKLCW*LLEKRGNPLARWTPSCCKVH 142 Y+E Y R CW LLE + N +A W +VH Sbjct: 156 YYEVYMDR--CWDLLEVKDNEIAVWDDKDGQVH 186 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 358 LENKVRQYYGS-DVAEEDEDNTVAGHMDLITFITKSECECLNEADDHPLAQA 510 L+ K+ Y S D +EEDED++ D+ + T+ E + A H AQA Sbjct: 95 LKEKIDTSYNSQDSSEEDEDDSSVQDFDIESLKTEMESTKESLAQAHEAAQA 146 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 28.3 bits (60), Expect = 3.3 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 1/88 (1%) Frame = +1 Query: 136 VVVDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRC-ADTASAQGVSAMPTFIFYR 312 V + F A+WCP + P F+ + + + + T S GV PT + Sbjct: 84 VALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKESSIKPSTLSKYGVHGFPTLLLL- 142 Query: 313 NRTKIDRLEGGNTTVLENKVRQYYGSDV 396 N T R G T +L++ V Y SDV Sbjct: 143 NSTMRARYRG--TRMLDSLVAFY--SDV 166 >At5g63030.1 68418.m07907 glutaredoxin, putative similar to glutaredoxin [Ricinus communis] gi|1732424|emb|CAA89699 Length = 125 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 139 VVDFTATWCPPCQRIAPFFEQLPAKF 216 VV F+ T+C CQR+ QL A F Sbjct: 31 VVVFSKTYCGYCQRVKQLLTQLGATF 56 >At3g05675.2 68416.m00633 expressed protein Length = 441 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 127 TKLVVV-DFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDV 246 TK+ VV DF TW +++ EQL AV ++V V Sbjct: 272 TKMEVVRDFVITWADISEKLVKVVEQLETTVVEAVEIRVKV 312 >At3g05675.1 68416.m00632 expressed protein Length = 441 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 127 TKLVVV-DFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDV 246 TK+ VV DF TW +++ EQL AV ++V V Sbjct: 272 TKMEVVRDFVITWADISEKLVKVVEQLETTVVEAVEIRVKV 312 >At1g49700.1 68414.m05572 expressed protein ; expression supported by MPSS Length = 245 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 109 QSGNEHHFELQWLSPWFKTNSIGSADKLEIRLCIS 5 + + HH E+Q L W +TN G A+ + LC+S Sbjct: 76 EPNDHHHDEVQTLEQWLETN--GFANIEDTFLCLS 108 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/70 (20%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +1 Query: 142 VDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADT---ASAQGVSAMPTFIFYR 312 V F WC C+++ +E L ++V C + + + + PTF+ + Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 313 NRTKIDRLEG 342 N ++ + +G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/70 (20%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +1 Query: 142 VDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADT---ASAQGVSAMPTFIFYR 312 V F WC C+++ +E L ++V C + + + + PTF+ + Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 313 NRTKIDRLEG 342 N ++ + +G Sbjct: 108 NGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/70 (20%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +1 Query: 142 VDFTATWCPPCQRIAPFFEQLPAKFPRAVFLKVDVDRCADT---ASAQGVSAMPTFIFYR 312 V F WC C+++ +E L ++V C + + + + PTF+ + Sbjct: 48 VKFCVPWCKHCKKLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFY 107 Query: 313 NRTKIDRLEG 342 N ++ + +G Sbjct: 108 NGEEVSKYKG 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,821,850 Number of Sequences: 28952 Number of extensions: 174667 Number of successful extensions: 617 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -