BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B01f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 0.71 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 8.7 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 8.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 8.7 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 8.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 0.71 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 246 RSGNKECPTCRKKLVSKRSLRPDPNFDLLISK--IYPSRDEYEAH 374 +S N P+C + + RPDP +L+I++ I S+ Y H Sbjct: 247 KSLNFRTPSCLETFHTLEKCRPDPPQNLVINESIIDLSQQTYNVH 291 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 8 IYWQNVFNRAFAK*NMGAIPLRVT 79 +Y VFN F + ++ +P+ VT Sbjct: 309 VYLAIVFNGLFTEEDVADVPINVT 332 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 234 ITALRSGNKECPTCRKKLVSKRSLRPDP 317 IT SGN TCR L + R +P Sbjct: 486 ITVNNSGNNRMGTCRIFLAPQFDERGNP 513 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 309 PDPNFDLLISKIYPSRDEYEAHQELV 386 P+P +K +P+ + Y HQ V Sbjct: 353 PNPQQQYYYNKNHPNSENYINHQNYV 378 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 309 PDPNFDLLISKIYPSRDEYEAHQELV 386 P+P +K +P+ + Y HQ V Sbjct: 301 PNPQQQYYYNKNHPNSENYINHQNYV 326 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,482 Number of Sequences: 336 Number of extensions: 2647 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -