Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS307A12f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    23   2.5  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    21   7.7  

>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 10/37 (27%), Positives = 18/37 (48%)
 Frame = -2

Query: 454 IWYPSTGFLLNTMKFSALIIMNRINFLQRIFSISSAC 344
           + Y  +  +LNT  F  ++  N + FL  + +   AC
Sbjct: 296 VQYEGSQDILNTQSFGKVVSKNGVLFLGLVGNSGIAC 332


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -1

Query: 68  PFNFLVMNIDY 36
           PF+FL++N+ Y
Sbjct: 368 PFSFLILNVVY 378


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,133
Number of Sequences: 438
Number of extensions: 2239
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)