BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307A11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 25 2.0 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 24 3.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 6.2 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 8.2 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 47 LTLAVRCCANFNGNICCRN 103 L + +CC N NGN C +N Sbjct: 156 LRMGDKCCRNGNGNGCGQN 174 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 87 IFVVVTLDLWTAHDPTDSPSTSTGHS 164 IFVVVTL+L AH D G S Sbjct: 11 IFVVVTLELVVAHPGKDVLGCHNGTS 36 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +2 Query: 239 RSQTEHSRTDHEYLQTICFFFLSYITYVYKICLLYVIGMWNVLNVVFYI 385 +S+T + D+ + IC F + ++ + Y I WN+ + V I Sbjct: 1647 QSETFSAVLDYLNMIFICIFSSECLMKIFALRYHYFIEPWNLFDFVVVI 1695 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 94 TNISVEIRTASHSKCQHTPRH 32 T+I V I SH K + P H Sbjct: 276 TSIDVAIEDGSHIKIEERPEH 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,125 Number of Sequences: 2352 Number of extensions: 9483 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -