BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307A11f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55440.1 68414.m06341 DC1 domain-containing protein contains ... 27 5.8 At5g48250.1 68418.m05961 zinc finger (B-box type) family protein... 27 7.7 >At1g55440.1 68414.m06341 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 271 RISTDNMFFFFKLHHLRLQNMFIICNRDVERVKCCFLHIMS 393 RI + + F H+L+LQ IC +D V C I+S Sbjct: 326 RIDVETIHHFSHEHYLKLQEKKTICEKDKYCVACTIPIIIS 366 >At5g48250.1 68418.m05961 zinc finger (B-box type) family protein contains similarity to CONSTANS homologs Length = 373 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -3 Query: 303 KKKKHIVCRYS*SVLECSVCERNVKTLMYKVW*SLSTRDGRRLTCRRC 160 +++ + CR + L C C+RNV + +LS R R L C RC Sbjct: 10 EQRSMVYCRSDAACL-CLSCDRNVHSAN-----ALSKRHSRTLVCERC 51 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,661,817 Number of Sequences: 28952 Number of extensions: 194444 Number of successful extensions: 474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -