BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307A04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0662 - 24103475-24103735,24103831-24104085,24104280-241044... 27 9.1 >01_05_0662 - 24103475-24103735,24103831-24104085,24104280-24104451, 24104535-24104762,24104864-24104997,24105101-24105184, 24105273-24105563,24105660-24105992,24106081-24106334, 24106435-24106591,24106674-24106777,24106879-24107039, 24107216-24107529,24107614-24107895,24107991-24108292, 24108367-24108457,24108566-24108619,24108785-24108861, 24108963-24109207,24109322-24109410,24110811-24111254 Length = 1443 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 220 GIMSR*SLKGLIEHPITLKKKNFFRCNTKTF*LTLQLVIIFLIYFLHPAEYSR 378 G+ + LK I+ + L K+N F K LTL +I+ +F + R Sbjct: 497 GVSRKELLKATIDRELLLMKRNAFMYIFKAVNLTLMALIVMTTFFRTSMRHDR 549 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,195,301 Number of Sequences: 37544 Number of extensions: 192289 Number of successful extensions: 332 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -