BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307A01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 3.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 3.3 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 4.4 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 4.4 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 256 YLWIFYKHFCTCILNMHNNKKVLILYLLRKNL*CFI 149 +LW+F+ F + L + ++ +I LL + C I Sbjct: 219 FLWLFWPSFNSAALEGDDQQRAIINTLLSISASCVI 254 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 89 SSKKKIIFLHNNLYIVNCV*YRNKIFYN 6 S ++KII +N YI N Y N YN Sbjct: 76 SKERKIISSLSNNYISNISNYNNNNNYN 103 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 89 SSKKKIIFLHNNLYIVNCV*YRNKIFYN 6 S ++KII +N YI N Y N YN Sbjct: 314 SKERKIISSLSNNYISNISNYNNNNNYN 341 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 89 SSKKKIIFLHNNLYIVNCV*YRNKIFYN 6 S ++KII +N YI N Y N YN Sbjct: 76 SKERKIISSLSNNYISNISNYNNDNNYN 103 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 165 FFLNKYKIKTFLLLCMFNMHVQKCL 239 +FLN YK K + ++H+Q + Sbjct: 666 YFLNDYKHKDVDVTLPLDLHIQNAI 690 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,956 Number of Sequences: 438 Number of extensions: 3248 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -