BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H12f (494 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6BGB8 Cluster: Ubiquitin protein ligase, putative; n=1... 33 4.6 UniRef50_Q9BI85 Cluster: Putative uncharacterized protein; n=2; ... 32 6.1 UniRef50_Q8ILF3 Cluster: Putative uncharacterized protein; n=1; ... 32 6.1 >UniRef50_Q6BGB8 Cluster: Ubiquitin protein ligase, putative; n=1; Paramecium tetraurelia|Rep: Ubiquitin protein ligase, putative - Paramecium tetraurelia Length = 908 Score = 32.7 bits (71), Expect = 4.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 200 NTYNNFFFFK*VQLHIYCRIK*RSQLE*GHIFKFTQNVYGSI 325 NT N+F F+ Q H C +K + + G F TQ YG I Sbjct: 679 NTINDFRFYDSDQYHRICNLKNQDVTDFGLTFSITQEFYGQI 720 >UniRef50_Q9BI85 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 396 Score = 32.3 bits (70), Expect = 6.1 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = -2 Query: 361 WHESTVGLY*QTYRSVYVLCEFKNMTLL*LRPSFDTTINMQLHLFKKK 218 W ST GL Y +V FKNMTL+ L S + T+ L+LF K+ Sbjct: 55 WLRSTTGLI-PYYVNVISATVFKNMTLVCLVESSENTLIRYLYLFSKQ 101 >UniRef50_Q8ILF3 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1225 Score = 32.3 bits (70), Expect = 6.1 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 5/76 (6%) Frame = +1 Query: 262 MKVAARVRS-YF*IHTKRIRIDMSVNTSQQLTRATIKS--IENSYPKNVWPKLI--CLHL 426 + + A +R+ Y + TKR I + + + + +K+ +NSYPK VW KLI L++ Sbjct: 537 LNIYASLRNEYIVVRTKRNNIFVLLRETPKWFLGWVKTRCFKNSYPKKVWKKLIEYFLNM 596 Query: 427 LNT*CSVYIYV*AHIP 474 + + +YV +IP Sbjct: 597 TKSNMNNNLYVSMYIP 612 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,415,889 Number of Sequences: 1657284 Number of extensions: 8296090 Number of successful extensions: 13044 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13040 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28855457139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -