BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H12f (494 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 28 0.89 SPAC977.02 |||S. pombe specific 5Tm protein family|Schizosacchar... 27 1.6 SPBC1348.03 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 27 1.6 SPAC750.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 1.6 SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schiz... 26 2.7 SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces po... 25 6.3 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 25 6.3 >SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 146 Score = 27.9 bits (59), Expect = 0.89 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 104 KFIVYLL*CYYQGGSK*TFL*ANLGFFFFSCLNTYNNFFFFK*VQLH 244 K ++YLL C+Y S+ + + F F C+ Y+N FF + ++ H Sbjct: 47 KLLIYLLYCWYIY-SEVPSVSSKFRSFTFGCVVVYHNKFFPRFIRTH 92 >SPAC977.02 |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 104 KFIVYLL*CYYQGGSK*TFL*ANLGFFFFSCLNTYNNFFFFK*VQLH 244 K ++YLL C+Y S+ + F F C+ Y+N FF + ++ H Sbjct: 47 KLLIYLLYCWYIY-SEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTH 92 >SPBC1348.03 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 146 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 104 KFIVYLL*CYYQGGSK*TFL*ANLGFFFFSCLNTYNNFFFFK*VQLH 244 K ++YLL C+Y S+ + F F C+ Y+N FF + ++ H Sbjct: 47 KLLIYLLYCWYIY-SEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTH 92 >SPAC750.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 104 KFIVYLL*CYYQGGSK*TFL*ANLGFFFFSCLNTYNNFFFFK*VQLH 244 K ++YLL C+Y S+ + F F C+ Y+N FF + ++ H Sbjct: 47 KLLIYLLYCWYIY-SEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTH 92 >SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 26.2 bits (55), Expect = 2.7 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 286 SYF*IHTKRIRIDMSVNTSQQLTRATIKSIENSYPKNV 399 S F +HTK+ I +++ L + ++ + SYP + Sbjct: 424 SEFQVHTKQKSIGQFIHSESDLLKPALQLLRQSYPMTI 461 >SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 635 Score = 25.0 bits (52), Expect = 6.3 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 111 INLYHTTYIYGWL 73 +N+ HTT I+GWL Sbjct: 38 VNILHTTDIHGWL 50 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 25.0 bits (52), Expect = 6.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 375 RE*LPKKCLAETNLFAFAQYIVFGIYL 455 RE + +KC++ +N F +Y+ +G L Sbjct: 556 REMVSEKCISLSNFNVFLEYVFYGTLL 582 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,001,945 Number of Sequences: 5004 Number of extensions: 39430 Number of successful extensions: 67 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -