BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H12f (494 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44820| Best HMM Match : 7tm_1 (HMM E-Value=9e-15) 28 3.7 SB_20470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_44820| Best HMM Match : 7tm_1 (HMM E-Value=9e-15) Length = 456 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -2 Query: 85 LRLVVFFFIK*ILPWHKTVKIIYFNPNQ 2 L +V+ F++ LP++ + IIYF+PN+ Sbjct: 369 LAIVICFYLS-FLPYYVALNIIYFHPNR 395 >SB_20470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 316 RIDMSVNTSQQLTRATIKSIENSYPKNVWPKL-ICL 420 R+DM+ + Q TR S+EN +PK KL +CL Sbjct: 42 RLDMTAGSPQ--TRPHFTSVENCFPKKTRNKLPLCL 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,174,287 Number of Sequences: 59808 Number of extensions: 263334 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -