BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 25 0.31 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 25 0.31 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 23 2.2 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.8 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 25.4 bits (53), Expect = 0.31 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 204 IFNAYLNENQNISFKV 251 +FN Y++ENQ + FK+ Sbjct: 16 VFNNYMDENQALGFKI 31 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 25.4 bits (53), Expect = 0.31 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 204 IFNAYLNENQNISFKV 251 +FN Y++ENQ + FK+ Sbjct: 36 VFNNYMDENQALGFKI 51 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/58 (20%), Positives = 28/58 (48%) Frame = +2 Query: 233 KYFFQSKNI*M*MYKLLFSEYSLLINSIIVKKKLISKRVVHYFINMQMYIKLFEHIRI 406 ++ F++ + + + L+F L ++ K K + ++H++ M + KL H I Sbjct: 126 RHIFRTSVLLIFVMHLMFDTLGGLYSTWSKKSKQVEYFLIHWYPRMLISTKLLAHFLI 183 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/58 (20%), Positives = 28/58 (48%) Frame = +2 Query: 233 KYFFQSKNI*M*MYKLLFSEYSLLINSIIVKKKLISKRVVHYFINMQMYIKLFEHIRI 406 ++ F++ + + + L+F L ++ K K + ++H++ M + KL H I Sbjct: 126 RHIFRTSVLLIFVMHLMFDTLGGLYSTWSKKSKQVEYFLIHWYPRMLISTKLLAHFLI 183 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 479 LVNYQIFMKNNNHVNWKMFCRHNFKFEYV 393 ++++ M + H W+ HNF EY+ Sbjct: 825 VLDFMSVMTYDYHGAWERQTGHNFTMEYL 853 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,275 Number of Sequences: 336 Number of extensions: 2387 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -