BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H04f (308 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 3.0 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 3.0 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 20 5.2 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 20 6.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 20 6.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 20 6.8 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 3.0 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 46 ELVACKSMNGSSSILLSFFALTAS*FGVQSSVALG 150 E+ ACK + +++LLS ++S + + LG Sbjct: 406 EITACKFFSIDNALLLSICGASSSYLFIMIQLDLG 440 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.0 bits (42), Expect = 3.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 168 FYYIIFFIARLIYVH 212 FY+IIF + Y+H Sbjct: 297 FYFIIFQVFESFYLH 311 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 20.2 bits (40), Expect = 5.2 Identities = 5/13 (38%), Positives = 10/13 (76%) Frame = +3 Query: 171 YYIIFFIARLIYV 209 YY++ F+ ++YV Sbjct: 100 YYLLLFVINVLYV 112 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 19.8 bits (39), Expect = 6.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 51 RRVQVYERIFKYSV 92 +R +VYE IFK V Sbjct: 80 KRREVYESIFKVEV 93 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 19.8 bits (39), Expect = 6.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 51 RRVQVYERIFKYSV 92 +R +VYE IFK V Sbjct: 240 KRREVYESIFKVEV 253 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 19.8 bits (39), Expect = 6.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 51 RRVQVYERIFKYSV 92 +R +VYE IFK V Sbjct: 240 KRREVYESIFKVEV 253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,251 Number of Sequences: 336 Number of extensions: 1218 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5624413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -