BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306H03f (431 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.14c |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 27 0.93 SPCC1259.02c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 25 3.8 >SPCC663.14c |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 687 Score = 27.5 bits (58), Expect = 0.93 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 186 INNFKQIQTCMAHVLRANTLVSLN*CI*-IGFKTKFCKFNVQLTNII 49 + F +IQT + V+ + + L +GFK FC F V LT ++ Sbjct: 489 VQQFAKIQTILLFVIEIISFILLAVFRPFVGFKNSFCVFLVALTRVV 535 >SPCC1259.02c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 822 Score = 25.4 bits (53), Expect = 3.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 262 CFRLGFLLKIFLESFS 215 CFRLG L IF+ FS Sbjct: 576 CFRLGLLFSIFVVGFS 591 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,780,024 Number of Sequences: 5004 Number of extensions: 34740 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -