BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 5.0 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 6.6 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.7 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 5.0 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -3 Query: 198 LKVEEVTKLYSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFSEEVI 52 L+ ++ L SS S + L +VIR TP+V + S+ + +++ Sbjct: 353 LRFGKILLLVSSTFRTISGRTIEDLFFKKVIRDTPIVAIISNMYKNQIL 401 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 108 SPAKPPTLSPRP 143 SP PPT SP P Sbjct: 94 SPTTPPTPSPPP 105 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 168 SSPSLRSSTVGVTALAALRVIRPTPMVFMNS 76 +S S+ +T+G +R TPM MNS Sbjct: 70 TSSSMGYTTIGSPISNRIRHEMATPMATMNS 100 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,708 Number of Sequences: 336 Number of extensions: 2009 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -