BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G10f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9.09 |met26||homocysteine methyltransferase|Schizosaccharomy... 25 6.8 SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non ca... 25 9.0 SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 25 9.0 >SPAC9.09 |met26||homocysteine methyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 764 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 47 YKMTSSENFDEFMKTIGVGLITR 115 +K++S++ DEF++ G+ITR Sbjct: 140 FKLSSTKALDEFLEAKEAGIITR 162 >SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non catalytic subunit Arm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 189 EEVTKLYSSPSLRSSTVGVTALAALRVIRPTPM 91 +E T +YS+ SL + G ALA L ++ TP+ Sbjct: 7 KESTIVYSALSLAQAGRGPEALALLEPLKSTPI 39 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 171 YSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFSEEVILY 46 + P + +T LAA R V N +KFS + +LY Sbjct: 240 HEDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFSVDFLLY 281 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,874,341 Number of Sequences: 5004 Number of extensions: 33117 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -