BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0484 - 29401195-29401404,29401572-29401755,29401866-294039... 29 2.3 08_02_0520 - 18121561-18121821,18122216-18122470,18122560-181227... 28 5.2 10_08_0308 + 16660751-16661450,16661656-16661819,16662615-166628... 27 9.1 04_01_0572 + 7404842-7405502,7405581-7406143,7406338-7406479,740... 27 9.1 03_02_0254 + 6862762-6863663,6863994-6864241,6864323-6864465,686... 27 9.1 >02_05_0484 - 29401195-29401404,29401572-29401755,29401866-29403973, 29404320-29404403,29404507-29404777,29404864-29405117, 29405513-29405722,29406357-29406503 Length = 1155 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/76 (26%), Positives = 37/76 (48%) Frame = +2 Query: 17 SIKMEFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTF 196 S+K V +K K+ +N + L + + T +L+K+ DEY + ++S Sbjct: 444 SLKATVVAEKEKILQEQN--------NLKLTEEERQEHIMLTAQLKKEIDEYRMRSNSLS 495 Query: 197 KTTEMKFKPGEEFEED 244 + TE K ++FEE+ Sbjct: 496 EETEDLRKQRQKFEEE 511 >08_02_0520 - 18121561-18121821,18122216-18122470,18122560-18122731, 18122824-18123105,18123159-18123292,18123425-18123508, 18123611-18123901,18123982-18124314,18124620-18124750, 18124826-18124930,18125011-18125167,18125248-18125351, 18125442-18125602,18125800-18126116,18126369-18126650, 18127011-18127312,18127609-18127699,18127771-18127824, 18128110-18128186,18128279-18128438,18128545-18128629, 18129059-18129367,18129514-18129890 Length = 1507 Score = 27.9 bits (59), Expect = 5.2 Identities = 27/105 (25%), Positives = 41/105 (39%) Frame = +2 Query: 65 ENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKFKPGEEFEED 244 E+ EF +++G RK V RKD +Y T ++ + P +EF Sbjct: 460 EHVLEFFESMGFKCPDRKGVADFLQEVTSRKDQQQYWARTHQPYR-----YIPVQEFA-C 513 Query: 245 RADGAKVKSVCTFRRXHP*SKSRRXPTVLKSLTSGNSXPEEMKSC 379 V + HP KS P L + T G S E +++C Sbjct: 514 AFQSFHVGQTLSDELSHPFDKSTSHPASLTTSTYGASKLELLRTC 558 >10_08_0308 + 16660751-16661450,16661656-16661819,16662615-16662800, 16663297-16663533 Length = 428 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 91 HRRGSDHPQSRQRCHPDRGAP 153 HRRG RQRC RGAP Sbjct: 87 HRRGPSLVPGRQRCGGARGAP 107 >04_01_0572 + 7404842-7405502,7405581-7406143,7406338-7406479, 7406605-7407436,7407546-7407729 Length = 793 Score = 27.1 bits (57), Expect = 9.1 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +2 Query: 341 TSGNSXPEEMKSCDDS*GRDLHQSLQGPVKGLYSEXGSPGPPIHEHPRGT 490 TSG+S SC DS S G + G P PP H R T Sbjct: 471 TSGSSIDSSSGSCTDSSSCSYTYSPASSSSGTFKVNGPPAPP-PAHTRAT 519 >03_02_0254 + 6862762-6863663,6863994-6864241,6864323-6864465, 6864532-6864570,6865403-6865501 Length = 476 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 145 HGRGDSVGGFAGDQTHADGLH 83 HG G + G F G + H DG+H Sbjct: 271 HGFGRTNGQFLGGRAHGDGVH 291 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,936,153 Number of Sequences: 37544 Number of extensions: 252539 Number of successful extensions: 654 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -