BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 92 9e-21 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 26 0.88 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 3.6 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 3.6 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 3.6 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.2 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 92.3 bits (219), Expect = 9e-21 Identities = 42/82 (51%), Positives = 54/82 (65%) Frame = +2 Query: 38 GKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKF 217 GKKYKM SE FD++M +GVG++ RK N+++PTVEL K+GDEY T S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSSS 94 Query: 218 KPGEEFEEDRADGAKVKSVCTF 283 EF+E+ DG VKSVCTF Sbjct: 95 SWAMEFDEETVDGRMVKSVCTF 116 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 429 KDSTPRXGVRGRRFTNIP 482 K+ T R GV+G RFT +P Sbjct: 208 KEVTVRGGVKGYRFTTVP 225 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 116 KAANAVTPTVELRKDGDEYNLVTSST 193 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 116 KAANAVTPTVELRKDGDEYNLVTSST 193 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 116 KAANAVTPTVELRKDGDEYNLVTSST 193 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 136 GDSVGGFAGDQTHA 95 G G FAGD+TH+ Sbjct: 988 GSDDGSFAGDKTHS 1001 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 136 GDSVGGFAGDQTHA 95 G G FAGD+TH+ Sbjct: 986 GSDDGSFAGDKTHS 999 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 471,957 Number of Sequences: 2352 Number of extensions: 8476 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -