BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G09f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024449-1|ABC86511.1| 1403|Drosophila melanogaster GH15984p pro... 33 0.23 AL031884-2|CAB40750.1| 704|Drosophila melanogaster EG:23E12.5 p... 33 0.23 >BT024449-1|ABC86511.1| 1403|Drosophila melanogaster GH15984p protein. Length = 1403 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 377 SPRTTVYE*H*NQSKLFSSRPKPEMLRHKQPPLLPRAERESHP 505 SP T Y H K RP P+ +R +PP +P + S P Sbjct: 286 SPSLTSYAAHVEAKKKMPPRPPPKNIRRVEPPTIPSQQLSSSP 328 >AL031884-2|CAB40750.1| 704|Drosophila melanogaster EG:23E12.5 protein. Length = 704 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 377 SPRTTVYE*H*NQSKLFSSRPKPEMLRHKQPPLLPRAERESHP 505 SP T Y H K RP P+ +R +PP +P + S P Sbjct: 286 SPSLTSYAAHVEAKKKMPPRPPPKNIRRVEPPTIPSQQLSSSP 328 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,642,088 Number of Sequences: 53049 Number of extensions: 425771 Number of successful extensions: 964 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -