BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G09f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-7|AAB37074.4| 529|Caenorhabditis elegans Cytochrome p450... 33 0.12 Z93778-6|CAB07843.2| 554|Caenorhabditis elegans Hypothetical pr... 28 4.7 Z93389-10|CAB07674.1| 417|Caenorhabditis elegans Hypothetical p... 28 4.7 Z93379-11|CAB07595.1| 417|Caenorhabditis elegans Hypothetical p... 28 4.7 AY523514-1|AAR98636.1| 554|Caenorhabditis elegans acetylcholine... 28 4.7 >U53148-7|AAB37074.4| 529|Caenorhabditis elegans Cytochrome p450 family protein 32A1 protein. Length = 529 Score = 33.1 bits (72), Expect = 0.12 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 143 KWYHTRQP*HAKFYFRVVADYIKTFIKSASV 235 KW+H R+ F+F ++ DY F+++A V Sbjct: 146 KWFHRRKMLTPTFHFTIIQDYFPVFVRNAEV 176 >Z93778-6|CAB07843.2| 554|Caenorhabditis elegans Hypothetical protein C31H5.3 protein. Length = 554 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 461 YDVTFPVSVLTRIVCFGFN 405 YDVTF VS+ R + +GFN Sbjct: 217 YDVTFTVSIRRRTLYYGFN 235 >Z93389-10|CAB07674.1| 417|Caenorhabditis elegans Hypothetical protein F21H7.10 protein. Length = 417 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 375 SHRGLQYTNSIETKANYSRQD 437 SHRG+++TN+I +KA + Q+ Sbjct: 365 SHRGIKHTNTIYSKATIAHQE 385 >Z93379-11|CAB07595.1| 417|Caenorhabditis elegans Hypothetical protein F21H7.10 protein. Length = 417 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 375 SHRGLQYTNSIETKANYSRQD 437 SHRG+++TN+I +KA + Q+ Sbjct: 365 SHRGIKHTNTIYSKATIAHQE 385 >AY523514-1|AAR98636.1| 554|Caenorhabditis elegans acetylcholine receptor (63.2 kD)(acr-19) protein. Length = 554 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 461 YDVTFPVSVLTRIVCFGFN 405 YDVTF VS+ R + +GFN Sbjct: 217 YDVTFTVSIRRRTLYYGFN 235 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,349,987 Number of Sequences: 27780 Number of extensions: 226893 Number of successful extensions: 490 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -