BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 1.9 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 2.5 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 2.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 4.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 4.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 4.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 4.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 4.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 4.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 4.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 4.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 4.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.4 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 4.4 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 4.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 5.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 5.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 5.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 5.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 5.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 5.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 5.8 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 7.7 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 372 TSHRGLQYTNSIETKANYSRQDRNRKCY 455 T H Y + K NY+ + N+K Y Sbjct: 89 TIHNNNNYKYNYNNKYNYNNNNYNKKLY 116 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +3 Query: 348 TGKNSPDTTSHRGLQYTNSIETKANYSRQDRNRKCYVISNH 470 TG++ S R L+Y + Y + D +C ++ H Sbjct: 2 TGQSVEAVMSLRALKYPMVVHVYHPYRQPDGMNQCQAVNGH 42 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +3 Query: 348 TGKNSPDTTSHRGLQYTNSIETKANYSRQDRNRKCYVISNH 470 TG++ S R L+Y + Y + D +C ++ H Sbjct: 2 TGQSVEAVMSLRALKYPMVVHVYHPYRQPDGMNQCQAVNGH 42 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREAWLIQQERE 50 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 4.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 468 HPCCQEPSENLT 503 +PCC EP ++T Sbjct: 229 YPCCTEPYSDIT 240 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 431 SRPKPEMLRHKQPPLLPRAERE 496 SR K E L+H++ L + ERE Sbjct: 29 SRTKEERLQHRREVWLIQQERE 50 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 351 GKNSPDTTSHRGLQY 395 GKN TT H G+ Y Sbjct: 147 GKNLGGTTLHHGMAY 161 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,385 Number of Sequences: 438 Number of extensions: 2705 Number of successful extensions: 31 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -