BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G07f (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 24 0.92 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 23 1.6 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 4.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 8.6 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 8.6 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 21 8.6 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 23.8 bits (49), Expect = 0.92 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 369 KEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDHSRLVRKC 488 K+++ T+LQ +R +LG + + Y D + + + +C Sbjct: 16 KDVQETILQ----EMRDVLGDIHAKPTYSDLQNLKYLERC 51 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = +3 Query: 387 VLQTLEGHLRAILGTLTVEEVYKDRDHSRLVRKC 488 V +++ +R +LG L+ + Y D + + + +C Sbjct: 18 VQESIVAEMREVLGDLSKKPSYNDLQNLKYLERC 51 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 159 TIVGGWAWAWCLVTDVQRIS 218 T+VGG +A+CL+ ++ ++ Sbjct: 80 TLVGGPEYAYCLLPPLESLA 99 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +1 Query: 340 PASSSWARPSK 372 P++SSW +P+K Sbjct: 1161 PSTSSWQKPTK 1171 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 Query: 177 AWAWCLV 197 AW WCL+ Sbjct: 130 AWMWCLI 136 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 Query: 177 AWAWCLV 197 AW WCL+ Sbjct: 130 AWMWCLI 136 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 Query: 177 AWAWCLV 197 AW WCL+ Sbjct: 130 AWMWCLI 136 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.6 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 Query: 177 AWAWCLV 197 AW WCL+ Sbjct: 130 AWMWCLI 136 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 83 GQHPHCRS*RGANSFRWL 136 G P RS +G +FRWL Sbjct: 64 GVMPIERSGKGRTTFRWL 81 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 83 GQHPHCRS*RGANSFRWL 136 G P RS +G +FRWL Sbjct: 64 GVMPIERSGKGRTTFRWL 81 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 173 MGMGLVSGYGRPTYIP*SDDIEPD 244 +G+G + P Y P D +PD Sbjct: 88 VGIGQFLVHRNPKYFPNPDKFDPD 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,703 Number of Sequences: 336 Number of extensions: 3101 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -