BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G07f (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 27 0.38 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 1.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 3.5 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 3.5 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 3.5 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 3.5 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 4.6 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 6.1 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 27.1 bits (57), Expect = 0.38 Identities = 24/91 (26%), Positives = 34/91 (37%) Frame = -3 Query: 295 TPVTVSGTPWAVSTYSHIGFNVITSRDIRWTSVTRHQAHAHPPTMVRFVVGPKQPPETIS 116 T T + P +T+S + T+ W T PPT + P PP T + Sbjct: 193 TATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPPTTTTWSDLPPPPPTTTT 252 Query: 115 ASLGPTVWMLPILNPFTVTFTIHTLHFTTKT 23 TVW +P T T T +T + T Sbjct: 253 T----TVW----TDPTTTTTTDYTTAYPPTT 275 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 1.5 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 18 VIVLVVKCSVCIVKVTVKGFKMG 86 V+++ CS+C + TVK + G Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTG 157 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 142 PKQPPETISASLGPTVWMLPILNPFTVT 59 P QPPET++ + + + P + P T T Sbjct: 1471 PVQPPETLTPAGSVAITVEPSVPPATTT 1498 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 175 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 56 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 175 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 56 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 175 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 56 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 4.6 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 175 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 56 H T + V PK T + ++ PT P P TF Sbjct: 112 HTITRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +3 Query: 282 TVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 404 ++ G+A CK + + + L K + K + QT E Sbjct: 10 SIHGIASCKRHRDPNAIQRVAREGLAKGISIKKCDIFQTCE 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,619 Number of Sequences: 2352 Number of extensions: 13674 Number of successful extensions: 24 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -