BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G07f (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 24 1.1 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 24 1.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 24 1.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 3.3 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 22 4.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 5.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 7.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 7.5 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 10.0 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 120 IVSGGCFGPTTKRTIVGGWAWAW 188 IV+G PT + GG AW+W Sbjct: 153 IVNGKRVPPTNWVGVFGGSAWSW 175 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 142 PKQPPETISASLGPTVWMLPILNPFTVTF 56 P +PP+ + +L W+ +NPF F Sbjct: 333 PVEPPDILMPALTWLGWINSAINPFIYAF 361 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 120 IVSGGCFGPTTKRTIVGGWAWAW 188 IV+G PT + GG AW+W Sbjct: 153 IVNGKRVPPTNWVGVFGGSAWSW 175 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -2 Query: 233 CHHFKGYTLDVRNQTPGPCP 174 CH GY DV Q CP Sbjct: 247 CHCKPGYQADVEKQECTECP 266 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 5 IKQVCYRFSCEVQCVYRESHCKRIQNGQ 88 IK+ +SC + C +SH IQN + Sbjct: 68 IKKYLTNYSCFITCALEKSHI--IQNDE 93 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 443 FYCKSSENSSQMTLQRL-QDSHLNLF 369 + C+SS+NS +QR +LN++ Sbjct: 621 YMCQSSKNSENSIMQRASMKENLNVY 646 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 255 VETAQGVPLTVTGVAQCKIMNEDELLTTACEQFL 356 +E +G+ T + + C ++ DE+ + QFL Sbjct: 310 LEKYEGISSTPSQASSCSCLDCDEIRESLDTQFL 343 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 161 HSRWMGMGLVSGYGR 205 H + G+G+ +GYGR Sbjct: 198 HPQQHGLGVQNGYGR 212 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 20.6 bits (41), Expect = 10.0 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 340 PASSSWARPSKRLR*LSCKRWRVICELFSELLQ*K 444 P+S W + L+ K +++ + FSEL+Q K Sbjct: 236 PSSGHWQDQMSLPQMLADKIGKMVNQKFSELIQSK 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,256 Number of Sequences: 438 Number of extensions: 3804 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -