SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS306G05f
         (521 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    26   0.18 
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    21   6.6  
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    21   8.7  
AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory recept...    21   8.7  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 26.2 bits (55), Expect = 0.18
 Identities = 14/38 (36%), Positives = 18/38 (47%)
 Frame = +1

Query: 166  DFECDFGFMLSGEECIQNKSVKFDPYAVPVYCRPGQHY 279
            D +CD G     E C  +  V  + + VP  C PG HY
Sbjct: 1204 DDKCDSGQYYPHESC-SSFYVCVNGHLVPQNCAPGLHY 1240


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -3

Query: 255 HGDGVRIELHRLILN 211
           H +GVR  LH LI N
Sbjct: 79  HKEGVRKVLHHLIKN 93


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 20.6 bits (41), Expect = 8.7
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +1

Query: 238 PYAVPVYCRPG 270
           P  VPVY RPG
Sbjct: 398 PGYVPVYIRPG 408


>AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory receptor
           candidate 25 protein.
          Length = 314

 Score = 20.6 bits (41), Expect = 8.7
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +1

Query: 238 PYAVPVYCRPG 270
           P  VPVY RPG
Sbjct: 223 PGYVPVYIRPG 233


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,009
Number of Sequences: 336
Number of extensions: 2604
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12573240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -