BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 1.5 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 2.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.2 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 118 IYRPRSSVARTDPTVSLSKKQSAMTTQSW 204 +Y+ S+V RTD ++ K++ T + W Sbjct: 849 VYQRLSAVNRTDTRANIRKQERQATIEQW 877 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.6 bits (51), Expect = 2.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 459 PQLNHQLAVCGLVFHISLKDTELWIPHQKDAHEGCFSRHGSS 334 P L ++ L+ H L+ IP+ D H+G S H SS Sbjct: 673 PSLKEDNSLLSLIGHFFLQTP---IPNNGDVHQGGDSNHTSS 711 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 106 KVLMIYRPRSSVARTDPTVSLS 171 + L + +PRSS R+DP +S Sbjct: 998 ETLRLAQPRSSAGRSDPMFRMS 1019 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 545,170 Number of Sequences: 2352 Number of extensions: 11278 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -