BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G02f (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 29 3.0 SB_46189| Best HMM Match : bZIP_2 (HMM E-Value=3.3) 27 6.9 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 28.7 bits (61), Expect = 3.0 Identities = 27/74 (36%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = -2 Query: 474 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKIHNTKYNQYLKMS---- 307 L+ GST S++ IA +T L S F R Y H T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 306 -TTTCNCNSRDRVV 268 T C NSRDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_46189| Best HMM Match : bZIP_2 (HMM E-Value=3.3) Length = 445 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 141 VNASGDRKAVGHDGEVAGLPDIYSWF-ITPF*TTKDTV 31 V GD + HDG+ A L ++++ +TP+ + DT+ Sbjct: 404 VKCEGDEPVIMHDGKEATLREVFAMLNLTPYDLSVDTL 441 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,228,766 Number of Sequences: 59808 Number of extensions: 264259 Number of successful extensions: 818 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -