BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G02f (514 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical pr... 28 4.5 AF022975-1|AAB70675.3| 587|Caenorhabditis elegans Hypothetical ... 27 6.0 >Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical protein C29E6.1a protein. Length = 812 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 170 STMPWSSVRS*TPRETARPLDTMVKSPVFLTST 72 ST ++ + TP+ + +P T KSPV +T+T Sbjct: 388 STKKLTTTTTTTPKPSQKPTTTTTKSPVVITTT 420 >AF022975-1|AAB70675.3| 587|Caenorhabditis elegans Hypothetical protein K09C6.7 protein. Length = 587 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 396 RVQYACLHHRRRQFSHSRDWLWNRASERGCSFCNDLDI 509 R + HRR+++ R W+ RA + G S + D+ Sbjct: 159 RWDWTLARHRRKRYQKYRRWMAGRAKKMGLSVWRNCDM 196 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,444,996 Number of Sequences: 27780 Number of extensions: 196053 Number of successful extensions: 742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -