BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC36.04 |cys11|cys1a|cysteine synthase |Schizosaccharomyces po... 48 6e-07 SPAC3A12.17c |cys12|cys1b|cysteine synthase Cys12|Schizosaccharo... 40 3e-04 SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schiz... 31 0.14 SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr... 26 3.9 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 25 6.8 >SPBC36.04 |cys11|cys1a|cysteine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 351 Score = 48.4 bits (110), Expect = 6e-07 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +2 Query: 386 IYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 I + + IG TPL+RLN + + G C + AK EF NPGGS+KD Sbjct: 13 IVSGFIGAIGRTPLIRLNTLSNETG--CNILAKAEFQNPGGSVKD 55 >SPAC3A12.17c |cys12|cys1b|cysteine synthase Cys12|Schizosaccharomyces pombe|chr 1|||Manual Length = 395 Score = 39.5 bits (88), Expect = 3e-04 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = +2 Query: 386 IYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 I N + IG+T +VR+ + + G C++ AK EF+NPG S KD Sbjct: 42 IVNGVEGLIGNTKMVRIKSLSQATG--CDILAKAEFLNPGNSPKD 84 >SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 30.7 bits (66), Expect = 0.14 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 407 TIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPG 505 T G TP+ + R+ K G + E+FAK E N G Sbjct: 12 TFGPTPITSMKRLSKTLGGKVEIFAKREDCNSG 44 >SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 872 Score = 25.8 bits (54), Expect = 3.9 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = -1 Query: 251 ISNLMNVILLKQVLNQVTVSLSMPDTL*IVQIT*FQSTRLLRSIMNLFSFPRDCSRQGGA 72 +SN M ++ KQ+L+Q T+ LS+ L +I FQ L+ MNL S P + R G Sbjct: 250 LSNYMVILQQKQILSQDTI-LSIFTNL--NEILDFQRRFLVGLEMNL-SLPVEEQRLGAL 305 Query: 71 FL 66 F+ Sbjct: 306 FI 307 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.0 bits (52), Expect = 6.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 382 VASKTS*IGHFLDQN*SSFKQY*IQLTNALPIKFLLINIRTAR 254 VA + IG F +S + I++ NA+ + L +N+RTAR Sbjct: 278 VAQRVDSIGRFAVATSASVHEA-IRIANAISKENLAVNVRTAR 319 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,974,544 Number of Sequences: 5004 Number of extensions: 35749 Number of successful extensions: 76 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -