BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G01f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X88562-1|CAA61252.1| 551|Homo sapiens cystathionine beta-syntha... 69 1e-11 X82166-1|CAA57656.1| 551|Homo sapiens cystathionine beta-syntha... 69 1e-11 L19501-1|AAA19874.1| 551|Homo sapiens cystathionine beta-syntha... 69 1e-11 L14577-1|AAA98524.1| 551|Homo sapiens cystathionine beta-syntha... 69 1e-11 BT007154-1|AAP35818.1| 551|Homo sapiens cystathionine-beta-synt... 69 1e-11 BC011381-1|AAH11381.1| 551|Homo sapiens CBS protein protein. 69 1e-11 BC010242-1|AAH10242.1| 551|Homo sapiens CBS protein protein. 69 1e-11 BC007257-1|AAH07257.1| 551|Homo sapiens CBS protein protein. 69 1e-11 BC000440-1|AAH00440.1| 551|Homo sapiens CBS protein protein. 69 1e-11 AF042836-2|AAC64683.1| 551|Homo sapiens cystathionine beta-synt... 69 1e-11 AF042836-1|AAC64684.1| 565|Homo sapiens cystathionine beta-synt... 69 1e-11 AL137314-1|CAB70691.1| 475|Homo sapiens hypothetical protein pr... 67 3e-11 >X88562-1|CAA61252.1| 551|Homo sapiens cystathionine beta-synthase protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >X82166-1|CAA57656.1| 551|Homo sapiens cystathionine beta-synthase protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >L19501-1|AAA19874.1| 551|Homo sapiens cystathionine beta-synthase protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >L14577-1|AAA98524.1| 551|Homo sapiens cystathionine beta-synthase protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >BT007154-1|AAP35818.1| 551|Homo sapiens cystathionine-beta-synthase protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >BC011381-1|AAH11381.1| 551|Homo sapiens CBS protein protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >BC010242-1|AAH10242.1| 551|Homo sapiens CBS protein protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >BC007257-1|AAH07257.1| 551|Homo sapiens CBS protein protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >BC000440-1|AAH00440.1| 551|Homo sapiens CBS protein protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >AF042836-2|AAC64683.1| 551|Homo sapiens cystathionine beta-synthase major isoform protein. Length = 551 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >AF042836-1|AAC64684.1| 565|Homo sapiens cystathionine beta-synthase minor isoform protein. Length = 565 Score = 68.5 bits (160), Expect = 1e-11 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 383 RIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +I +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 75 KILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 >AL137314-1|CAB70691.1| 475|Homo sapiens hypothetical protein protein. Length = 475 Score = 67.3 bits (157), Expect = 3e-11 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +2 Query: 395 NILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 +IL+ IGDTP+VR+N+I K +GL+CE+ AKCEF N GGS+KD Sbjct: 3 DILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 44 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,287,366 Number of Sequences: 237096 Number of extensions: 1036002 Number of successful extensions: 1573 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1573 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -