BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306G01f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058508-1|AAL13737.1| 522|Drosophila melanogaster LD21426p pro... 76 3e-14 AE014298-3078|AAF50863.1| 522|Drosophila melanogaster CG1753-PB... 76 3e-14 AE014298-3077|AAF50862.1| 522|Drosophila melanogaster CG1753-PA... 76 3e-14 AE014297-3469|AAS65203.1| 356|Drosophila melanogaster CG33338-P... 28 8.8 >AY058508-1|AAL13737.1| 522|Drosophila melanogaster LD21426p protein. Length = 522 Score = 76.2 bits (179), Expect = 3e-14 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 377 RNRIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 R +I NILE IG TPLV+LN IP G+ECEM+AKCEF+NPGGS+KD Sbjct: 42 RQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKD 89 >AE014298-3078|AAF50863.1| 522|Drosophila melanogaster CG1753-PB, isoform B protein. Length = 522 Score = 76.2 bits (179), Expect = 3e-14 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 377 RNRIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 R +I NILE IG TPLV+LN IP G+ECEM+AKCEF+NPGGS+KD Sbjct: 42 RQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKD 89 >AE014298-3077|AAF50862.1| 522|Drosophila melanogaster CG1753-PA, isoform A protein. Length = 522 Score = 76.2 bits (179), Expect = 3e-14 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 377 RNRIYNNILETIGDTPLVRLNRIPKDYGLECEMFAKCEFVNPGGSIKD 520 R +I NILE IG TPLV+LN IP G+ECEM+AKCEF+NPGGS+KD Sbjct: 42 RQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKD 89 >AE014297-3469|AAS65203.1| 356|Drosophila melanogaster CG33338-PA protein. Length = 356 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 509 NHRDSRIRILQTFHIPSHSLLEF 441 NHR+ I +L FH P+H+++EF Sbjct: 75 NHRNV-ISLLNVFHPPAHNMMEF 96 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,460,600 Number of Sequences: 53049 Number of extensions: 346878 Number of successful extensions: 540 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -