BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306F09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0528 + 9189215-9189330,9190111-9190204,9190654-9190743,919... 28 5.2 >03_02_0528 + 9189215-9189330,9190111-9190204,9190654-9190743, 9191601-9191717,9192187-9192259,9192335-9192453, 9192569-9192690,9192777-9192953,9193189-9193333, 9193458-9193636,9193742-9193991 Length = 493 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 208 STWIIIHYLLHIFQTSMTAVSIIIFLYMYVIKKIVRLIEF 327 S W ++H + TS+ + +IIF M +++K+ L+E+ Sbjct: 104 SYWKMMHKYIGADVTSLVTLPVIIFEPMTMLQKMAELMEY 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,149,669 Number of Sequences: 37544 Number of extensions: 165690 Number of successful extensions: 266 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 266 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -