BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306F08f (495 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 5.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.2 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 21 7.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.5 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.5 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = +2 Query: 398 WELP*WRDHRLRSSKSWPCKSEICRIPF 481 W W DH L+ + S + R+P+ Sbjct: 57 WVTQIWTDHHLKWNASEFAGIRVIRVPY 84 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -3 Query: 334 WLGRSRRCPDCPRDLASTTLTSTPKQGKSKAFSKCS 227 W+G R DL + L G S A S CS Sbjct: 485 WIGAGRDSDSRLLDLCTKFLMHKDSLGLSTATSTCS 520 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.0 bits (42), Expect = 7.2 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -3 Query: 232 CSRNSIILNLYIF 194 CSRNS++ ++Y + Sbjct: 46 CSRNSLMTHIYTY 58 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 69 DRRERGRSREHRIIPSH 85 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 298 RDLASTTLTSTPKQGKSKA 242 +D TLT+ PK K+K+ Sbjct: 207 KDGIPVTLTTVPKHSKTKS 225 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 317 DRRGRGRSREHRIIPSH 333 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 302 DRRERGRSREHRIIPSH 318 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 285 DARSRGQSGHLRDLPNH 335 D R RG+S R +P+H Sbjct: 318 DRRERGRSREHRIIPSH 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,387 Number of Sequences: 438 Number of extensions: 3402 Number of successful extensions: 20 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -