BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306F07f (479 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) 31 0.37 SB_18108| Best HMM Match : HA (HMM E-Value=0.059) 29 2.6 >SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1308 Score = 31.5 bits (68), Expect = 0.37 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 99 LIFIEYMYIFNIYSYKKKTKI*VFIIRLMYNGN*SFETTPLTVGCAVRSPPRSMSLCH 272 +IF+E+M++ S + +++ + G + P VG +V S RS+S CH Sbjct: 134 VIFLEFMFLMGSVSIISTPIMLYWLLETLTGGGSWRDALPFAVGISVMSYVRSVSWCH 191 >SB_18108| Best HMM Match : HA (HMM E-Value=0.059) Length = 282 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 8 EKIHVLSILFVQKNKIRFLSEVYY 79 EK+H LS + +Q+ KIR L E Y+ Sbjct: 77 EKVHALSEVKIQQQKIRRLKEKYF 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,992,947 Number of Sequences: 59808 Number of extensions: 273063 Number of successful extensions: 539 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -