BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306F07f (479 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 3.0 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 3.0 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 3.0 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 3.0 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 3.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 3.9 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 6.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.9 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 66 PKYITKIDNLCLIFIEYMYIFNIYSYKKK 152 PK I+ + N + Y Y +N +Y KK Sbjct: 79 PKIISSLSNNTIHNNNYKYNYNNNNYNKK 107 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 66 PKYITKIDNLCLIFIEYMYIFNIYSYKKK 152 PK I+ + N + Y Y +N +Y KK Sbjct: 79 PKIISSLSNNTIHNNNYKYNYNNNNYNKK 107 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 66 PKYITKIDNLCLIFIEYMYIFNIYSYKKK 152 PK I+ + N + Y Y +N +Y KK Sbjct: 79 PKIISSLSNNTIHNNNYKYNYNNNNYNKK 107 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 66 PKYITKIDNLCLIFIEYMYIFNIYSYKKK 152 PK I+ + N + Y Y +N +Y KK Sbjct: 79 PKIISSLSNNTIHNNNYKYNYNNNNYNKK 107 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 398 KLYVTL*RPSVPALHQMSWY 457 K+Y L R + PAL ++WY Sbjct: 39 KVYNLLYRVAQPALANITWY 58 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 398 KLYVTL*RPSVPALHQMSWY 457 K+Y L R + PAL ++WY Sbjct: 39 KVYNLLYRVAQPALANITWY 58 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 233 APDGKRRRLKRSISVIHQAN 174 A DG RRR+ + S I +AN Sbjct: 431 AQDGLRRRMDKLKSSIEEAN 450 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 6.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 221 KRRRLKRSISVIHQANYEHLDFCFFFITINI 129 +RRR R SV + F FF+ IN+ Sbjct: 410 RRRRTPRYNSVSKIDRASRIVFPLFFLAINV 440 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 299 VGPPASVPPTHFCMYKEW 352 +G PA++ T CM W Sbjct: 204 IGDPANIEFTELCMKLGW 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,688 Number of Sequences: 438 Number of extensions: 2568 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -