BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306F03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 28 0.17 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 8.2 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 28.3 bits (60), Expect = 0.17 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 5/75 (6%) Frame = +1 Query: 127 NFSEPTLKNMPQQNV*ILETSFQKQKQETLQRK-----DASTVHATICSLWTACLVLKVT 291 NF P N + ++ K+E L++K + T+H SLW A + L Sbjct: 1094 NFLTPRYVNRKGVALPTSSEETKRAKRENLEQKQILVPELCTIHPFPASLWRAAVCLPCV 1153 Query: 292 FYVICSLLAMTSSRR 336 Y I +LL RR Sbjct: 1154 LYRINALLLADEIRR 1168 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 389 CWILCEIRRLYGHSIWSYKG 448 C++LC I +S WS +G Sbjct: 15 CFVLCVIHIRKKYSFWSERG 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,052 Number of Sequences: 2352 Number of extensions: 10644 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -