BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E12f (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.068 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 23 1.5 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 3.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 5.9 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.8 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 27.5 bits (58), Expect = 0.068 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +3 Query: 201 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLKTLC-LCTH 377 + L FS ++ + F +++ F SE + +++ YFR + KT C L T Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKTFCTLVTA 412 Query: 378 SSFCGIRALAVPLLL 422 +C + + LL Sbjct: 413 LVYCSLAIFVLCELL 427 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 122 GGNTFLAALACLLHFIAAGLSLVAKHLRPGLLSLLPVDV 238 G +T L +CLLH + L+ + G L + + V Sbjct: 268 GVHTLLILFSCLLHLVVTPYYLLIEVCNAGYLPFILLQV 306 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 3.4 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +3 Query: 339 RSNFLKTLCLCTHSSFCGIRALAVPLLLQSH 431 RSN+ K CL G A LL+ H Sbjct: 81 RSNWFKIHCLLQEQQQAGANMAAAANLLRPH 111 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 92 SEGLQQFLLLGGNTFLAALACL 157 SE ++QFL TF+A LA L Sbjct: 461 SEMVKQFLFTQKFTFVAGLATL 482 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 7.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 154 PPSLYCGGPQPGR 192 P SLYCG P G+ Sbjct: 356 PWSLYCGEPPCGQ 368 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,307 Number of Sequences: 336 Number of extensions: 1874 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -