BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.2 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 2.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 2.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 8.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.7 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -3 Query: 333 RHSQPVPGLT*GTQCTLFPGTCYQKAWTLHN 241 ++S + G+ TQC + PG ++ + +HN Sbjct: 141 KNSPYMDGVPFVTQCPIHPGMTFRYHFNVHN 171 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +1 Query: 232 STDIMESPSLLVTSPWKKSTLGTSRQPRHWLTMPTSSITFKKMKSN 369 S D S + + S ++ T GT+ P L P IT+ + N Sbjct: 20 SGDSTSSATSIDLSTFRVPTYGTTSHPTSKLVPPDERITYSWTEIN 65 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +1 Query: 232 STDIMESPSLLVTSPWKKSTLGTSRQPRHWLTMPTSSITFKKMKSN 369 S D S + + S ++ T GT+ P L P IT+ + N Sbjct: 20 SGDSTSSATSIDLSTFRVPTYGTTSHPTSKLVPPDERITYSWTEIN 65 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 309 AQALADYADLINYLQKDE 362 A +L Y DL+ Y K+E Sbjct: 618 ANSLRQYEDLLEYEAKEE 635 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = +2 Query: 407 WNVSCLYKDKVSPPSGRSYSRLSSHT 484 WN C S P G + ++HT Sbjct: 179 WNNPCSINSTSSQPVGTQIHQQTNHT 204 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 135 FVVIIFVALSSWSGHSCLLSLYLDEKL 55 FV+ I VAL+ ++ + +LYL KL Sbjct: 247 FVIKILVALNFFTSTLEIDNLYLKHKL 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,777 Number of Sequences: 336 Number of extensions: 3080 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -