BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E09f (350 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 29 1.1 SB_40598| Best HMM Match : Stap_Strp_toxin (HMM E-Value=2.7) 29 1.1 SB_1847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) 28 2.4 SB_3594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_33977| Best HMM Match : CUE (HMM E-Value=0.52) 27 3.2 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 5.7 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_48996| Best HMM Match : ASC (HMM E-Value=7.1e-08) 26 7.5 SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) 26 7.5 SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) 26 7.5 SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) 26 9.9 SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 26 9.9 SB_53232| Best HMM Match : OAR (HMM E-Value=0.92) 26 9.9 SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 26 9.9 SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 26 9.9 SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 30.7 bits (66), Expect = 0.35 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 68 KAHRNGIKKPRKTRHESTLGM 130 K HRNGIKKPR R+ S G+ Sbjct: 175 KWHRNGIKKPRTNRYPSLKGV 195 >SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 29.9 bits (64), Expect = 0.61 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 20 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQR 157 IK N HNQ + + KK RK RH DP+ L+ ++ Sbjct: 123 IKQTSDNNKPQHNQKNTSKK---KKKRKDRHRKKQDQDPEPLKEKK 165 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 29.1 bits (62), Expect = 1.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 23 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 121 K AKSK NH ++ K R KK ++T +ST Sbjct: 145 KNAKSKIKRNHGEDNKPKRISTKKRKRTDKDST 177 >SB_40598| Best HMM Match : Stap_Strp_toxin (HMM E-Value=2.7) Length = 192 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 29 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMD 133 +K+ N TN NQ K P+KT ++T+ D Sbjct: 153 SKNNNQTNRNQGNTGITENTKSPKKTNIDATVPSD 187 >SB_1847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 27.9 bits (59), Expect = 2.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 93 SQGRPGTNPPLAWIQN 140 S GRPG N P+AW+ + Sbjct: 31 SPGRPGPNAPIAWVND 46 >SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) Length = 622 Score = 27.9 bits (59), Expect = 2.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 17 LIKMAKSKNHTNHNQNRKAH-RNGIKKPRKTRHESTL 124 LI KSK+H NHN+ + H + I K H+ T+ Sbjct: 571 LIVYCKSKHHANHNKGCERHFEDDINKCGCRNHDHTI 607 >SB_3594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 17 LIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLR 148 +I + + H +HN +R + N IK + RH T F R Sbjct: 114 VIGVVRHVRHDDHNLSRSHNNNAIKSRNQNRHFVTQSQQHVFTR 157 >SB_33977| Best HMM Match : CUE (HMM E-Value=0.52) Length = 1183 Score = 27.5 bits (58), Expect = 3.2 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +3 Query: 12 ENSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNP 119 E +W +R++ + + KL E + ++GR P Sbjct: 1031 EKYREWHMKRVLPLFVQDTKLREKIENAEGRTSGGP 1066 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 26 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHE 115 + S +HN + R GIK+PR+++ E Sbjct: 342 LTTSPTMISHNNQQNDSRRGIKRPRRSQEE 371 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 26.6 bits (56), Expect = 5.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 14 KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 121 K IK AK N+N RK G K+P++ R ++T Sbjct: 86 KPIKKAKVSK-VNNNGRRKEKNRGQKRPKRCRPDTT 120 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 195 SRGRLREKLPEKQRPRNE 248 SRGR EK PEKQR +++ Sbjct: 267 SRGRSAEKSPEKQRDKSD 284 >SB_48996| Best HMM Match : ASC (HMM E-Value=7.1e-08) Length = 294 Score = 26.2 bits (55), Expect = 7.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 68 CGFGYDLYDSLT 33 CGFGY LY S+T Sbjct: 41 CGFGYQLYKSIT 52 >SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) Length = 538 Score = 26.2 bits (55), Expect = 7.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 68 CGFGYDLYDSLT 33 CGFGY LY S+T Sbjct: 41 CGFGYQLYKSIT 52 >SB_36161| Best HMM Match : SecIII_SopE_N (HMM E-Value=4.1) Length = 535 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/58 (24%), Positives = 22/58 (37%) Frame = +2 Query: 23 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 196 K K K +H N NG+ P+K + + + K ++ C N K L Sbjct: 92 KFKKIKKEGDHGNNNTEKPNGVSSPKKKKKKHHHKHEEKHFTDRDHCILDNPKEKTHL 149 >SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) Length = 943 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 74 HRNGIKKPRKTRHESTLGMDPKFLRNQR 157 H+N + PR +R T P F RNQR Sbjct: 373 HKNIRRIPRASRGSITQARGPDFARNQR 400 >SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 9/70 (12%) Frame = +2 Query: 14 KLIKMAKSKNHTNHNQN---------RKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCK 166 K IK AK K++ N+N RKA R K +TR E K + QR Sbjct: 16 KEIKRAKDKDYYEKNRNKKIAQVIERRKARREETKGKSRTRTEIKKAASKKRRKEQRATA 75 Query: 167 KGNLKPAKQL 196 + L+ +Q+ Sbjct: 76 REELERKRQI 85 >SB_53232| Best HMM Match : OAR (HMM E-Value=0.92) Length = 806 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 9/70 (12%) Frame = +2 Query: 14 KLIKMAKSKNHTNHNQN---------RKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCK 166 K IK AK K++ N+N RKA R K +TR E K + QR Sbjct: 38 KEIKRAKDKDYYEKNRNKKIAQVIERRKARREETKGKSRTRTEIKKAASKKRRKEQRATA 97 Query: 167 KGNLKPAKQL 196 + L+ +Q+ Sbjct: 98 REELERKRQI 107 >SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 838 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 9/70 (12%) Frame = +2 Query: 14 KLIKMAKSKNHTNHNQN---------RKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCK 166 K IK AK K++ N+N RKA R K +TR E K + QR Sbjct: 16 KEIKRAKDKDYYEKNRNKKIAQVIERRKARREETKGKSRTRTEIKKAASKKRRKEQRATA 75 Query: 167 KGNLKPAKQL 196 + L+ +Q+ Sbjct: 76 REELERKRQI 85 >SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 25.8 bits (54), Expect = 9.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 9/70 (12%) Frame = +2 Query: 14 KLIKMAKSKNHTNHNQN---------RKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCK 166 K IK AK K++ N+N RKA R K +TR E K + QR Sbjct: 16 KEIKRAKDKDYYEKNRNKKIAQVIERRKARREETKGKSRTRTEIKKAASKKRRKEQRATA 75 Query: 167 KGNLKPAKQL 196 + L+ +Q+ Sbjct: 76 REELERKRQI 85 >SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 38 KNHTN-HNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQR 157 +NH HN+NRK N I+K R+ D + R Sbjct: 66 RNHKEPHNRNRKEPGNRIRKVEHNRNRKDYSRDERIHNRSR 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,066,028 Number of Sequences: 59808 Number of extensions: 172264 Number of successful extensions: 527 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -