BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E08f (488 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.18 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.18 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 32 0.24 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 0.96 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 2.9 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 2.9 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 27 5.1 At1g64260.1 68414.m07281 zinc finger protein-related contains Pf... 27 5.1 At3g12520.1 68416.m01558 sulfate transporter family protein simi... 27 6.8 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.18 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +3 Query: 69 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 236 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.18 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +3 Query: 69 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 236 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.9 bits (69), Expect = 0.24 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 216 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 314 +++D + EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 0.96 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 42 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 143 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 108 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 224 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 108 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 224 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.5 bits (58), Expect = 5.1 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +1 Query: 16 NFSLYLRCACSPPAR--ASLN---YPRTLLTKTSRRNCTT 120 NFSL L+C PP + LN +P TL+ K+ CTT Sbjct: 228 NFSLDLQCVFHPPKQNPHDLNIHDHPLTLMPKSISFTCTT 267 >At1g64260.1 68414.m07281 zinc finger protein-related contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 719 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 216 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 314 +++D + +Y KL + +G + K+FPL F Sbjct: 379 IVVDTKSLNGKYQLKLMIASGVDAANKFFPLAF 411 >At3g12520.1 68416.m01558 sulfate transporter family protein similar to sulfate transporter [Arabidopsis thaliana] GI:3777483; contains Pfam profiles PF00916: Sulfate transporter family, PF01740: STAS domain Length = 677 Score = 27.1 bits (57), Expect = 6.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 234 RNTMEYCYKLWVGNGQEIVRKYFPLNFRLIMAGNYVKIIYRNYNLALKLGSTTNPSNERI 413 RN +Y + + NG IVR P+ F I +Y+K R Y +A+ ++ P ERI Sbjct: 501 RNMKQYP-EAYTYNGIVIVRIDAPIYFANI---SYIKDRLREYEVAIDKHTSKGPDMERI 556 Query: 414 AY 419 + Sbjct: 557 YF 558 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,867,359 Number of Sequences: 28952 Number of extensions: 218369 Number of successful extensions: 561 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -