BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 40 1e-05 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 2.9 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 5.0 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.6 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 40.3 bits (90), Expect = 1e-05 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 4/109 (3%) Frame = +1 Query: 94 NSLVFLLYLLSGRPDWQRKINSELPPYA----MLCSEDLAGAPSVRAAINEAFRLLPTAP 261 + + F + L+ P Q K+ E+ + + L + + EA RL P+ P Sbjct: 3 SGIAFAILCLAENPKVQEKLYEEVAAVIDNIENITMQQLQEMKYLEMVLKEAQRLYPSVP 62 Query: 262 FLARLLDSPMTIGGHKIPPGTFVLAHTAAACRXEENFWRAEEYLPERWI 408 + R L+ IGG+ P TF+ E+ F E++ P R++ Sbjct: 63 VIERRLEVDCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEPEKFDPNRYL 111 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 84 DASQQFGVSPVPTEWTSRLAKKN*FRTTTV 173 D S+ +P P +W + RTTTV Sbjct: 422 DGSKPVQTTPKPGQWVPEKSTSTTQRTTTV 451 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 103 PNCWLASQYRQL*SR*WQPSCRACPV 26 P C L+ Q S WQ S RA + Sbjct: 257 PKCVLSDHGTQFISNTWQNSLRAADI 282 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = +1 Query: 79 IETLANSLVFLLYLLSG 129 IET+A S++F+L+ + G Sbjct: 242 IETVAYSVIFILWHIVG 258 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,800 Number of Sequences: 336 Number of extensions: 2299 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -