BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E03f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0490 + 29456825-29457499,29458771-29459057,29460922-294610... 29 3.0 >02_05_0490 + 29456825-29457499,29458771-29459057,29460922-29461039, 29461451-29461972,29462058-29462170,29463033-29463053, 29463726-29463960,29464218-29464381,29464695-29464776, 29465077-29465166,29465625-29465858,29466347-29466418, 29466857-29467000,29467573-29467659,29467940-29468098, 29469216-29469476,29469789-29469836 Length = 1103 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -3 Query: 420 ANAVQNTNISYETNTHIY-NLKKFNTGR*ENSPH-LKCITFKYK 295 +++V++ N E I+ +LKKF +G +SP LKCI+ KYK Sbjct: 604 SSSVKSCNSQAEQKKTIHLHLKKFFSGTRFSSPSFLKCISSKYK 647 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,321,511 Number of Sequences: 37544 Number of extensions: 194577 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -