BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 27 1.3 SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr... 27 2.2 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 101 FSWGINYSLWSFRSSIPFFKYLVKCLGVLS 12 +S G+ + +W+F ++ P KY +K LS Sbjct: 109 YSGGLGFEVWAFMANDPSMKYWLKLTNQLS 138 >SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 194 NFNNKIDLEQLFNTFHGICNTNAEKQSLCPNNYENSF 304 N NK L L N FH + K SLC +++F Sbjct: 70 NEENKTKLAALLNRFHEETDNFLSKLSLCQQEIQDTF 106 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,085,435 Number of Sequences: 5004 Number of extensions: 40085 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -