BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306E01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 26 0.67 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 23 6.2 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 26.2 bits (55), Expect = 0.67 Identities = 12/55 (21%), Positives = 27/55 (49%) Frame = +1 Query: 103 KFRTIKY*NAVSVNKTLVLNKQWQIANNGKINIMQRWFFLEERKIQKTKPERKMS 267 KF+T++ N + K+W++A N + Q + + R+++ K ++ S Sbjct: 279 KFQTLELEKEFLFNAYVSKQKRWELARNLNLTERQVKIWFQNRRMKNKKNSQRQS 333 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 23.0 bits (47), Expect = 6.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 475 CEVLYRYAICFLNE 516 CE Y+ +CFL+E Sbjct: 141 CEAAYKQELCFLDE 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,846 Number of Sequences: 2352 Number of extensions: 11259 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -