BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D12f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 21 7.7 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.7 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 21.0 bits (42), Expect = 7.7 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 6/76 (7%) Frame = +1 Query: 283 IDKLKSQVHDIHVPTEVFDYIDQGRNPQL--YTKDCIDKALAKNEEVKGK----IDSYKR 444 I++LK Q+HD+ + IDQ + D D+ + E K +D Sbjct: 19 IEELKIQLHDVQEICKTESGIDQQTVDDINEVNFDVEDEKPQRYNECILKQFNIVDESGN 78 Query: 445 FKTHLLSELSKTFPNE 492 FK +++ EL+ + +E Sbjct: 79 FKENIVQELTSIYLDE 94 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +1 Query: 214 DFQPQGQSVLNQKIQSLVTGLQEIDKLKSQVH 309 DF+ + N+ L+T + E+D++ + H Sbjct: 524 DFKIEVTEDCNKSFNDLLTQVAELDQIYADTH 555 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,195 Number of Sequences: 438 Number of extensions: 2179 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -