BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.67 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 2.0 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.6 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 3.6 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 4.7 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 6.2 AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical prote... 23 8.2 AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosens... 23 8.2 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.67 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -1 Query: 251 FPSVNPGISWAPLRTITRAKTERLASTIHPR 159 +P + G + APLR+I + +++A+++HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.0 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 193 RPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSEDEHGCLS 71 +P+D+R+ + L VF +GA+ ++ T ED G S Sbjct: 856 KPKDFRKHSLLPLNNVFDRIKGALPHLKKSPTKEDATGGFS 896 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 3.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 198 SCYCAQGCPGN 230 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 3.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 59 FIGNPCLSLPPATRS 15 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 4.7 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -2 Query: 268 LDGGVHFHQSIQEFPGH 218 +DGG++ S++ FPG+ Sbjct: 167 VDGGLNIPHSVKRFPGY 183 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 6.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 208 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 315 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical protein protein. Length = 117 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = +2 Query: 308 LAKKMMYVVMSSNACSQLRKEKKTLNPDIRHLRSRG*SP 424 + + + V+ + C QL ++ K P++ R SP Sbjct: 48 IVSRQIMCVLEKSPCDQLGRQLKAALPEVIQRNCRNCSP 86 >AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosensory protein CSP4 protein. Length = 117 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = +2 Query: 308 LAKKMMYVVMSSNACSQLRKEKKTLNPDIRHLRSRG*SP 424 + + + V+ + C QL ++ K P++ R SP Sbjct: 48 IVSRQIMCVLEKSPCDQLGRQLKAALPEVIQRNCRNCSP 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 512,555 Number of Sequences: 2352 Number of extensions: 11347 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -