BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_699| Best HMM Match : NOA36 (HMM E-Value=5.6) 45 4e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_699| Best HMM Match : NOA36 (HMM E-Value=5.6) Length = 501 Score = 44.8 bits (101), Expect = 4e-05 Identities = 29/106 (27%), Positives = 55/106 (51%), Gaps = 3/106 (2%) Frame = +1 Query: 205 DEKGVIFFPPMYVQRYAAIVDCLLDERWSGKLEKVVDLGYHDMSFIKYL-KEVSGIKSIL 381 ++ G F PP+Y QRY +++ + + K ++V+D G + ++ L + I+ ++ Sbjct: 14 EQLGPKFDPPVYRQRYHRVIEVVKEH----KAKRVLDFGCAEAKMLRSLINSTTNIEELV 69 Query: 382 GVDLETIPLQCSSDLLS--CNEYAPKRETPLQISLLQGNAADPDYR 513 GVD++ L+ S + +Y R PL +SL QG+ + D R Sbjct: 70 GVDIDRDLLEDSIFRIRPLTTDYLTPRPHPLAVSLYQGSISKADDR 115 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 249 ICCYCRLSTGRTVERKIGKGGRPWLP 326 ICC+CR+ TV+ + G G+P +P Sbjct: 35 ICCWCRIKLIDTVDLEGGPVGKPVVP 60 >SB_16926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 45 YRYSNFNIFPPVSFNRIR 98 Y Y NF IF P+ F IR Sbjct: 7 YHYGNFKIFSPIKFGVIR 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,686,862 Number of Sequences: 59808 Number of extensions: 268981 Number of successful extensions: 607 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -