BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D07f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.5 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 4.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 4.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 4.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 4.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 5.8 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 467 NGVSLLGAYSLQLNKSDEHCNGIVSRSTPKIDL 369 NG LL Y +E+C+GI S +ID+ Sbjct: 97 NGGPLLAPYPDWTWAKNENCSGITSAYKIEIDM 129 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 STSYDYRYSNFNIFPPVSFN 89 S S +Y+YSN+N + ++N Sbjct: 84 SLSNNYKYSNYNNYNNNNYN 103 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 STSYDYRYSNFNIFPPVSFN 89 S S +Y+YSN+N + ++N Sbjct: 84 SLSNNYKYSNYNNYNNNNYN 103 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 STSYDYRYSNFNIFPPVSFN 89 S S +Y+YSN+N + ++N Sbjct: 84 SLSNNYKYSNYNNYNNNNYN 103 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 STSYDYRYSNFNIFPPVSFN 89 S S +Y+YSN+N + ++N Sbjct: 84 SLSNNYKYSNYNNYNNNNYN 103 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 94 LDRLLRPYFQKFALSLT 144 LDR LRPY + A LT Sbjct: 1174 LDRELRPYLRTAAAILT 1190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,530 Number of Sequences: 438 Number of extensions: 2810 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -