BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D06f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-5|CAC48119.1| 576|Caenorhabditis elegans Hypothetical ... 28 4.7 Z79695-2|CAB01971.2| 1008|Caenorhabditis elegans Hypothetical pr... 27 6.2 >AL132876-5|CAC48119.1| 576|Caenorhabditis elegans Hypothetical protein Y105E8A.5 protein. Length = 576 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 110 FREKSIVSQKIEYNYI*QKHATKCQV 33 FR K+ K++YN + Q HA K Q+ Sbjct: 386 FRRKANFDTKLDYNQVPQAHALKLQI 411 >Z79695-2|CAB01971.2| 1008|Caenorhabditis elegans Hypothetical protein F27D4.6 protein. Length = 1008 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -2 Query: 121 FTENLEKNLS*AKR*NTITYSKNTQPNVKCDFCLSFNTYQ 2 F + + + L+ K ++ +KNT+ N KC FC++ ++ Q Sbjct: 576 FNDKINELLTLIKSKSSEEKAKNTRVNWKCTFCVNLHSNQ 615 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,854,932 Number of Sequences: 27780 Number of extensions: 278603 Number of successful extensions: 787 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -