BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D02f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 43 2e-04 SB_45837| Best HMM Match : Fez1 (HMM E-Value=0.77) 40 0.001 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 38 0.007 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 37 0.009 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 37 0.012 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 36 0.015 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 36 0.015 SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) 36 0.027 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_5283| Best HMM Match : Ank (HMM E-Value=3.1e-09) 36 0.027 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 35 0.035 SB_37103| Best HMM Match : DUF164 (HMM E-Value=0.26) 35 0.035 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 35 0.047 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 34 0.082 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_28483| Best HMM Match : Filament (HMM E-Value=0.0082) 33 0.14 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.19 SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) 33 0.19 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 32 0.25 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 32 0.33 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_8393| Best HMM Match : DUF662 (HMM E-Value=3.9e-26) 31 0.44 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 31 0.44 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_20371| Best HMM Match : U-box (HMM E-Value=0.075) 31 0.44 SB_56032| Best HMM Match : zf-CCHC (HMM E-Value=0.00047) 31 0.58 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 31 0.76 SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_55835| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) 30 1.0 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 30 1.0 SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) 30 1.3 SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) 30 1.3 SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) 30 1.3 SB_6220| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0089) 30 1.3 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 1.8 SB_47026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) 29 1.8 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 29 1.8 SB_29745| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.04) 29 1.8 SB_24402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 29 1.8 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 29 1.8 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 29 2.3 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 29 2.3 SB_9721| Best HMM Match : Filament (HMM E-Value=0.2) 29 2.3 SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) 29 2.3 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 29 2.3 SB_45619| Best HMM Match : M (HMM E-Value=0.01) 29 2.3 SB_43708| Best HMM Match : TPR_2 (HMM E-Value=0.011) 29 2.3 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_45938| Best HMM Match : Troponin (HMM E-Value=1) 29 3.1 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 3.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11854| Best HMM Match : Neuromodulin (HMM E-Value=7.3) 29 3.1 SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) 28 4.1 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 28 4.1 SB_27931| Best HMM Match : Filament (HMM E-Value=0.028) 28 4.1 SB_11461| Best HMM Match : NHL (HMM E-Value=0) 28 4.1 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 28 4.1 SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) 28 4.1 SB_47479| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 28 4.1 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 28 4.1 SB_55202| Best HMM Match : FIVAR (HMM E-Value=3.7) 28 5.4 SB_37547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_33454| Best HMM Match : PAN (HMM E-Value=0.0013) 28 5.4 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 28 5.4 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_53408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 28 5.4 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 28 5.4 SB_11809| Best HMM Match : Rabaptin (HMM E-Value=0.8) 28 5.4 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 28 5.4 SB_2494| Best HMM Match : M (HMM E-Value=0.0056) 28 5.4 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 27 7.1 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 27 7.1 SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) 27 7.1 SB_34845| Best HMM Match : CXC (HMM E-Value=0.03) 27 7.1 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 27 7.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 27 7.1 SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_58300| Best HMM Match : AAA_5 (HMM E-Value=0) 27 7.1 SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40) 27 7.1 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) 27 7.1 SB_23812| Best HMM Match : Filament (HMM E-Value=0.05) 27 7.1 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 27 7.1 SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) 27 7.1 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 27 7.1 SB_4346| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 27 7.1 SB_57183| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) 27 9.4 SB_50756| Best HMM Match : S-antigen (HMM E-Value=2.4e-09) 27 9.4 SB_44119| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_29722| Best HMM Match : HLH (HMM E-Value=4.9e-14) 27 9.4 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 27 9.4 SB_7838| Best HMM Match : Filamin (HMM E-Value=1.1e-22) 27 9.4 SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) 27 9.4 SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 27 9.4 SB_15566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 44.0 bits (99), Expect = 8e-05 Identities = 27/89 (30%), Positives = 50/89 (56%), Gaps = 8/89 (8%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS---CSNERDILKANLSVKTLEYDEI 411 L EK +K+++E+TDL+ KH ++S+E + E +S + E + ++ L K E +E+ Sbjct: 895 LREKLEKLETEYTDLEKKHSQISEEKAIVAEQLESEREVAQETEEMRQRLQTKKNELEEL 954 Query: 412 KVNFDVMKTENED-----LQRKTKLLEEV 483 + + TE E+ + K KLL+E+ Sbjct: 955 LSDLEGRITEEEENVLALTEDKKKLLKEI 983 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/82 (24%), Positives = 45/82 (54%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K + DL + + ++ +DL++K V +E ++K F ++ + N S T EY Sbjct: 182 KRQVKDLEMEKQSLEKSVSDLREKVKLVENEKSELKFAFDELDSKYRVCDENRSSITNEY 241 Query: 403 DEIKVNFDVMKTENEDLQRKTK 468 ++++ F+ + TE ++++R+ K Sbjct: 242 EDMRARFNEVDTERQEIRRELK 263 >SB_45837| Best HMM Match : Fez1 (HMM E-Value=0.77) Length = 264 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/148 (24%), Positives = 68/148 (45%), Gaps = 6/148 (4%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNN--VTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKM 264 PP++ +K S NN ++KV+ + +A D K F +L ++ K+ Sbjct: 23 PPLTTQRSFLKDDTFMLSRKGKRNNKAISKVKPKQYLALLQNFTDLKVEFLNLEDEKHKL 82 Query: 265 KSEFTDLKDKHLEVSDEYEKIKETFQSCSNERD----ILKANLSVKTLEYDEIKVNFDVM 432 ++ +DK+ ++S E+E++KE + + D I + N ++ L K+ D + Sbjct: 83 ENALLRSEDKYAKLSQEHEQLKEKYSELEHLEDWGRIIREKNAEIRRLNEVLKKLRTDRV 142 Query: 433 KTENEDLQRKTKLLEEVTFSLKQKSFEL 516 + NE K + E+ LKQK E+ Sbjct: 143 EALNEKTTAKA-AIGELKCRLKQKRKEV 169 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 37.5 bits (83), Expect = 0.007 Identities = 24/101 (23%), Positives = 49/101 (48%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 ++ L+E + DL++K +++D IK+ NE + LK L+ T Sbjct: 2421 EYSGEKTKLVEAEGNLARVQRDLEEKEKKLND----IKQASDLSENEGNRLKEELNAFTE 2476 Query: 397 EYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 YDE++ + K EN+ L+++ +L++ L+ +L+ Sbjct: 2477 RYDELRASHMSTKKENDKLRQEVSVLKQNFGQLQNDKEDLE 2517 Score = 33.5 bits (73), Expect = 0.11 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 5/88 (5%) Frame = +1 Query: 250 KHKKMKSEFTD-----LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 K K EFT+ LK + + +YE++++ + ++ + L E + Sbjct: 2255 KQLKASKEFTEGQLETLKQSLVLSTQDYERLQDEQTTLQRTKESNEKELFDTLKRESEYQ 2314 Query: 415 VNFDVMKTENEDLQRKTKLLEEVTFSLK 498 + F+V + EN+DLQ++ LE+ T +L+ Sbjct: 2315 LRFEVAQQENDDLQKELCNLEKKTQTLE 2342 Score = 30.7 bits (66), Expect = 0.76 Identities = 18/86 (20%), Positives = 41/86 (47%) Frame = +1 Query: 259 KMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKT 438 +++SE ++ EV E I+ S S +++ ++ L+ Y+E+++ + Sbjct: 2550 RLQSEVKSSVEQLHEVRTHVEVIRTENVSSSKDKNFIEKKLTNLQTAYEELRLEKTSKQN 2609 Query: 439 ENEDLQRKTKLLEEVTFSLKQKSFEL 516 E +DL+ K +E+ K ++ L Sbjct: 2610 EVDDLREKLSQIEKEHVLSKDSNYSL 2635 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/83 (19%), Positives = 39/83 (46%) Frame = +1 Query: 250 KHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDV 429 +++ M+ E + +++ L+ + ++ + +E+D L+ + E++ ++ Sbjct: 1545 QNELMELERREFQEELLQTQQRVQDLEASLNISQDEKDRLEEEVRSFYKRISELQTSYQA 1604 Query: 430 MKTENEDLQRKTKLLEEVTFSLK 498 + E D QR+ LLE LK Sbjct: 1605 CEHEKLDAQREVTLLEHKVTKLK 1627 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/76 (26%), Positives = 38/76 (50%) Frame = +1 Query: 250 KHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDV 429 ++ + KS FT + H +S + + +T Q +RD + + TLE ++I + + Sbjct: 2358 ENSESKSRFTQIN--HEVLSLQKDLANKTAQITKFQRDTFDKDNRLTTLEIEKIDIEKKL 2415 Query: 430 MKTENEDLQRKTKLLE 477 ++E KTKL+E Sbjct: 2416 ESLKDEYSGEKTKLVE 2431 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/73 (23%), Positives = 34/73 (46%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTE 441 +KSE +L+++ ++E I + C E+D L L+ E + +K E Sbjct: 730 LKSEKEELEEELKRFKHDFELIGNDLKMCKKEKDQLHVELTNIKQRLAETESASSRLKGE 789 Query: 442 NEDLQRKTKLLEE 480 E L ++ +++E Sbjct: 790 REKLHKELTVMKE 802 Score = 29.1 bits (62), Expect = 2.3 Identities = 25/93 (26%), Positives = 41/93 (44%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKV 417 DL EK KK+ D+K +E ++KE + + D L+A+ E D+++ Sbjct: 2442 DLEEKEKKLN----DIKQASDLSENEGNRLKEELNAFTERYDELRASHMSTKKENDKLRQ 2497 Query: 418 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 V+K LQ + LE +K+ EL Sbjct: 2498 EVSVLKQNFGQLQNDKEDLEIERDRVKRHLAEL 2530 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/72 (20%), Positives = 36/72 (50%) Frame = +1 Query: 196 APKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKA 375 A K+ F+A+ + ++++ ++ + +KD+ + +EY +++ F D + Sbjct: 1184 ASKMRVSKFEAQAHSIVKQRDSLREQLDSVKDELRKSKEEYAVLQKEFIDHQKRCDSYRN 1243 Query: 376 NLSVKTLEYDEI 411 L KT E ++I Sbjct: 1244 QLLSKTHEMEKI 1255 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 14/84 (16%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYE-----------KIKE---TFQSCSNERDILKA 375 +L E+ K + +++ K++EVS +YE K+K+ ++ C ER LK Sbjct: 2123 ELRERVKTCTKKLYEVESKYMEVSIQYETAKKEVNLQKMKVKDLVSVYERCEKERKELKE 2182 Query: 376 NLSVKTLEYDEIKVNFDVMKTENE 447 V + ++++ D TE E Sbjct: 2183 KTVVTASKVSQLEMRLDHETTERE 2206 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 37.1 bits (82), Expect = 0.009 Identities = 21/71 (29%), Positives = 38/71 (53%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 EK ++E DL+ K +E ++ K++ + RD LK++L V+ ++ E+K N Sbjct: 494 EKLNIRENERADLERKVMESDNKLAKLQSQLDAALTARDRLKSDLQVEKMKAGELKNNLI 553 Query: 427 VMKTENEDLQR 459 + E +LQR Sbjct: 554 KTEAEVAELQR 564 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/99 (18%), Positives = 46/99 (46%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 + +F +L +H ++ L + E+ + ++ ++ +N+++ L+ Sbjct: 1795 RKKFGNLRAEHDDLQHANHGLILQGQELESKAADLEHRLETEANDKNKLRQENITLASSL 1854 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 +E KVN+ +K EN+ LQ + + L+ ++ L+ Sbjct: 1855 NEYKVNYLTLKKENDRLQNEISAINRKLVYLETRNENLE 1893 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/72 (22%), Positives = 33/72 (45%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTE 441 ++ E +DK L++ E Q S+E+ L+A + +YD++ + E Sbjct: 2326 LQEEKNKSQDKILDLQKELSSRTHELQKVSSEKGKLEAAFDILQKKYDDLMEERTELIEE 2385 Query: 442 NEDLQRKTKLLE 477 E L ++ ++E Sbjct: 2386 KETLVKELDIME 2397 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTE 441 M S +L+ + + S+ +K + +RD L+ + V + + ++ + E Sbjct: 443 MVSRVQELESQLDDTSNSVNNLKSDYDMVLRDRDDLRKEIEVISTKLTTTNEKLNIRENE 502 Query: 442 NEDLQRK 462 DL+RK Sbjct: 503 RADLERK 509 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/88 (22%), Positives = 47/88 (53%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L ++++K+K E ++K + E+ +E+ + +N ++I A +YD +K++ Sbjct: 2246 LRDENEKLKVELANIKKDYKELQVTHEETN--YVMATNVQEIEAAPELPD--DYDAVKLD 2301 Query: 421 FDVMKTENEDLQRKTKLLEEVTFSLKQK 504 + +++EN +L K K E L+++ Sbjct: 2302 NERLQSENNNLIGKLKNNENTINILQEE 2329 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 37.1 bits (82), Expect = 0.009 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 3/92 (3%) Frame = +1 Query: 235 NDLLEKHK---KMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYD 405 NDL E ++SE DLK+K ++ E+++ET Q E + N + K +E Sbjct: 3078 NDLSEAESTIDSLRSENKDLKNKCALITQRAERLEETVQLEREESEKTIGNWNDKMME-- 3135 Query: 406 EIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 +K F E +DL+ K + EE S K+ Sbjct: 3136 -LKSQFTRTSDERDDLKAKLEETEETLASTKE 3166 Score = 34.3 bits (75), Expect = 0.062 Identities = 23/104 (22%), Positives = 53/104 (50%), Gaps = 3/104 (2%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 + + +++DL+++ +++KS+ ++ E+ E ++K + N + + A ++ Sbjct: 2819 ELRLKYDDLVKEREEVKSDLATTRE---ELRQEQIELKNARKEGENMKKHVMAEKDARSK 2875 Query: 397 EYDEIKVNFDVMKTEN---EDLQRKTKLLEEVTFSLKQKSFELD 519 E+ + + MKT+ ++LQR LEE L++K LD Sbjct: 2876 VEQELHESNEQMKTQKRNIQELQRNVSKLEEENAVLEEKVKLLD 2919 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/97 (18%), Positives = 48/97 (49%) Frame = +1 Query: 229 RFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 408 R +LL++ + ++ +F L+ ++ + + E +KE+ + R +++ + + E Sbjct: 2259 REEELLDEMRAVRQQFAPLETRNELLKADIEALKESNRGMEESRTKIESEIKSTKAKMCE 2318 Query: 409 IKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 +++ + K EN+ L+ + L E ++ K E + Sbjct: 2319 MEITNEAYKEENDRLRSEIIALSEEKCEVECKVSEAE 2355 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = +1 Query: 259 KMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKA-NLSVKTLEYDEIKVNFDVMK 435 KMK E + DK + D +K + +I+K NL++KT + +E+K +F Sbjct: 1816 KMKLERVEGDDK--KQKDRLFSLKSACSEANEAYEIVKKQNLALKT-DLEELKKSFADKN 1872 Query: 436 TENEDLQRKTKLLEE 480 E E+ +R+ + LEE Sbjct: 1873 MEVENNRREKERLEE 1887 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 36.7 bits (81), Expect = 0.012 Identities = 23/97 (23%), Positives = 45/97 (46%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K N L K K E +DL+D+ E YEK+ Q E + K L+ +T Sbjct: 671 KNEINSLKAKLAKANDELSDLRDELSETKQGYEKV---MQKAKQEASLFKEKLNEETGRS 727 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFE 513 +++ + ++K + DL++ + + S ++++ E Sbjct: 728 RDVEGDRALLKAQIADLRKDLEASLAASMSREKETME 764 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 36.3 bits (80), Expect = 0.015 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +1 Query: 244 LEKHKKMKSEFT-DLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L+ K +E T +L+ + LE DE E+ Q+C +ERD +N S + + E+ Sbjct: 654 LKGELKASTEKTAELEQQLLEGLDEKERELSALQACLDERD---SNCSALEISFHEVNSK 710 Query: 421 FDVMKTENEDLQRK 462 + MK E E +Q K Sbjct: 711 AEEMKAEFEGIQEK 724 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 36.3 bits (80), Expect = 0.015 Identities = 23/103 (22%), Positives = 51/103 (49%), Gaps = 3/103 (2%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETF---QSCSNERDILKANLSV 387 + K NDL K ++K++ + L+ +++ +++KE + + D+L A L+ Sbjct: 25 ELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQLKEQRTLNEKAMKDTDLLNARLTK 84 Query: 388 KTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 ++++ +N D + +EN + K E+ +LKQ + L Sbjct: 85 VQQDFEQQLMNCDQLASENTQKAAELKAKEDEINTLKQDTVRL 127 >SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) Length = 1211 Score = 35.5 bits (78), Expect = 0.027 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 4/118 (3%) Frame = +1 Query: 178 EKRSTVAPKIPPYDFKARFNDLLEKHKKMKS--EFTDLKDKHLEVSDEYEKIKETFQSCS 351 +K V IP D R L + ++ +S E ++ + + + DE F Sbjct: 144 KKSERVMRTIPQLDEVLRELTRLNESRRTESDKEIVNILKRRIILFDEITNKDMAFVLQE 203 Query: 352 NERDI--LKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 + L +NL E +++K +MK EN++L+ K + LE+ KSF+L+ Sbjct: 204 KNEIVRNLTSNLDTLNAEIEQLKSASQLMKRENKELELKVQELEKFAKEKAAKSFDLE 261 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K L+E +K+ +E L+D ++ EY+ K +++ NER+ L L Sbjct: 765 KENIRSLVEDREKLMNENKSLQDTWCKMRLEYQTAKVEYEALRNEREALAKELKQGLHST 824 Query: 403 DEIKVNFDV-MKTENEDLQRKTKLLEE 480 +E + D + N KL+ E Sbjct: 825 EEEDITTDTRQRARNSTNSTDEKLVRE 851 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 35.5 bits (78), Expect = 0.027 Identities = 21/68 (30%), Positives = 40/68 (58%) Frame = +1 Query: 244 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNF 423 L K K+++ DLK+K+L +S ++++ + S+ RD+ + +L+V TL+Y +V Sbjct: 787 LTKESKLQTSIRDLKEKNLALSRLNSELQQEVKQVSHARDVTQYSLTV-TLKY---RVTS 842 Query: 424 DVMKTENE 447 K+ NE Sbjct: 843 SSNKSRNE 850 >SB_5283| Best HMM Match : Ank (HMM E-Value=3.1e-09) Length = 481 Score = 35.5 bits (78), Expect = 0.027 Identities = 17/69 (24%), Positives = 37/69 (53%) Frame = +1 Query: 148 TTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKI 327 TT+ ++ + +I D +A+ + L++ ++MK E + LK+K DE +K+ Sbjct: 386 TTLVGKARARDEANLRKVQIQAKDIEAQISTKLKEIERMKLEVSSLKNKRKRCDDECDKL 445 Query: 328 KETFQSCSN 354 ++ SC++ Sbjct: 446 RKRLHSCAS 454 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 35.1 bits (77), Expect = 0.035 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 6/98 (6%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 D R N+L +K +K+ E +L D+ E+ E + + + + +N+R ++ + K Sbjct: 586 DVSTRRNELQKKQEKIIKENDELNDRINELKKENDYLAKEIKDFANKRKEMETSYEEKER 645 Query: 397 EYDEIKV------NFDVMKTENEDLQRKTKLLEEVTFS 492 E K D+ KT+N ++ L++ FS Sbjct: 646 ERQTEKAMGQLVEELDIQKTKNSEMTETASGLKDGVFS 683 Score = 32.3 bits (70), Expect = 0.25 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDL---KDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT 393 K + DL ++ + +K D+ K + E+ + E++++ S R+ L+ Sbjct: 543 KGKIKDLEDEVRYLKERLEDMAKEKTRRRELEKKIEELQDELDDVSTRRNELQKKQEKII 602 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTK 468 E DE+ + +K EN+ L ++ K Sbjct: 603 KENDELNDRINELKKENDYLAKEIK 627 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/67 (22%), Positives = 33/67 (49%) Frame = +1 Query: 280 DLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQR 459 D KD+ +V + YE++K + E++ + V + + + MK + +DL+ Sbjct: 492 DNKDEDPKVEEAYEELKIKYSKLVKEQENARGENGVASPHVKQSLYESESMKGKIKDLED 551 Query: 460 KTKLLEE 480 + + L+E Sbjct: 552 EVRYLKE 558 >SB_37103| Best HMM Match : DUF164 (HMM E-Value=0.26) Length = 387 Score = 35.1 bits (77), Expect = 0.035 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNER---DILKANLSVKT 393 KA DL E H K+K + D+K+ ++S+ E+ K+ + E+ + LK L+ Sbjct: 244 KAMKGDLKEYHTKLKIAYGDIKELKQQMSEWTEERKQIKSELNREKLTCEDLKGQLARAR 303 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTKLLE 477 E++ + + M TE L++ + + E Sbjct: 304 EEHESALQHHEFMLTEQYQLEKNSWIRE 331 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 34.7 bits (76), Expect = 0.047 Identities = 22/85 (25%), Positives = 41/85 (48%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K R L E+ +K E+ L + ++DE E I + + + I + VK L+ Sbjct: 299 KERLAKLEEQTRKYIDEYQSLSLRSRALADEAESILNNMEDTTEQ--IFQEKKVVKKLQV 356 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLE 477 DE ++ + + +N+ + K+KL E Sbjct: 357 DEEEIKHRISELQNQLAKNKSKLSE 381 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 33.9 bits (74), Expect = 0.082 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 2/88 (2%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDI--LKANLSVKTLEYDEIKVNFDVMK 435 ++++ LK ++ + E E + E+F+S +E LKA L + T E +++ + + + Sbjct: 1373 LEAQVKALKQQNDLLKAEKETLFESFKSGQDELSAGDLKARLGMCTKELKKVQDSSNEIH 1432 Query: 436 TENEDLQRKTKLLEEVTFSLKQKSFELD 519 EN+DL+ + K+ + SLK +++ Sbjct: 1433 KENQDLREELKMAKRHIESLKSTLIQVE 1460 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 33.5 bits (73), Expect = 0.11 Identities = 17/67 (25%), Positives = 36/67 (53%) Frame = +1 Query: 250 KHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDV 429 K+ +++ E L+ + +E+ DE K++E Q + L+A +YD +K ++ Sbjct: 208 KYDEIEKEKGVLEKEKIEIFDELNKLEERLQDLED----LQAQRFELQKKYDSLKEKYET 263 Query: 430 MKTENED 450 ++ EN+D Sbjct: 264 LRAENDD 270 Score = 28.7 bits (61), Expect = 3.1 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 6/112 (5%) Frame = +1 Query: 160 NNVTKVEKRSTVAPK---IPPYDFKARFNDLLEKHKKMK--SEFTDLKDKHLEVSD-EYE 321 N +T++E+R K + K N + KK+K +E + +K L+ +D E + Sbjct: 422 NRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKVRVLEKQLKENDAEIQ 481 Query: 322 KIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLE 477 +K+ + +E + L + EY+ I +K ENE L+ + L+ Sbjct: 482 GLKDDNERLEDELEDLSTTIKRGRAEYERILKENAELKDENEALKAEIDALK 533 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +1 Query: 34 SDVDKKNLITNHTRPLRNGPPVSAAAPRIKRS 129 S+VD L+T+ R LRN P+SA P I+R+ Sbjct: 1464 SEVDPAQLLTDIQRKLRNDSPMSAGTPEIERA 1495 >SB_28483| Best HMM Match : Filament (HMM E-Value=0.0082) Length = 478 Score = 33.1 bits (72), Expect = 0.14 Identities = 26/133 (19%), Positives = 63/133 (47%), Gaps = 1/133 (0%) Frame = +1 Query: 121 KRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHL 300 +RSA + + T + + + D + R D +EK+K + E +K Sbjct: 296 QRSALETKLFAVTSECTSLNIKLQRLQEETEQDIENRIQDAIEKYKSLPDELASMKAVLD 355 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLS-VKTLEYDEIKVNFDVMKTENEDLQRKTKLLE 477 +DE +++++ E D L+ ++ LE + ++F V++T+++ ++ + E Sbjct: 356 MKNDEIKQLRKDRMEAKMELDHLRTKADRIRKLEQENESLSF-VVETKSKFERQLSVERE 414 Query: 478 EVTFSLKQKSFEL 516 + +L+++S +L Sbjct: 415 TLKTTLERESAKL 427 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 32.7 bits (71), Expect = 0.19 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 6/124 (4%) Frame = +1 Query: 10 SRTIANGLSDVDKKNL----ITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKV 177 SR ANGLS+ +KKN I + T ++G V RI++ P T N+ + Sbjct: 471 SRKTANGLSEEEKKNRPKCPICDQTFDTQSGLDVHGRIHRIRKRGRPP---TRSNSKKQP 527 Query: 178 EKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKD--KHLEVSDEYEKIKETFQSCS 351 ++ PK D + + + K K + + KD K E+ D+ +E+ + Sbjct: 528 PRKRGRKPKSEKKDTEEGNKEKEKGDDKAKDKTEESKDGEKKEEIGDKKSDKEESAEKNE 587 Query: 352 NERD 363 +E+D Sbjct: 588 SEKD 591 >SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) Length = 161 Score = 32.7 bits (71), Expect = 0.19 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 2/82 (2%) Frame = +1 Query: 244 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE-IKVN 420 L + +++KS F D K EV YE+IKE FQ ++++ ++ L V + ++ + + Sbjct: 57 LNQLEEVKSCFKDGKKSKAEVRVLYERIKERFQDIQDKQERIEICLEVIDEKKEKLVDLK 116 Query: 421 FDVMK-TENEDLQRKTKLLEEV 483 +V K E + + +L+E+V Sbjct: 117 NEVAKHAEENNEEELDRLIEDV 138 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 32.3 bits (70), Expect = 0.25 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 5/92 (5%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNE-RDILKANLSVKTLEYD---- 405 L EK ++S D KD+++E + +E +NE ++LK+ L Y+ Sbjct: 98 LQEKELDVQS-VRDAKDRNIEELKAKLQEREAMLESANEGEELLKSQLEAAKQFYESASR 156 Query: 406 EIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 ++ V D ++++NE LQR+ + S+K+ Sbjct: 157 DLNVTLDDLRSKNEQLQRQLSQKDNQLQSMKE 188 Score = 27.1 bits (57), Expect = 9.4 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 10/107 (9%) Frame = +1 Query: 229 RFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 408 + DL + KM+ EF K ++ + DE K+ T S + + T + E Sbjct: 500 KMEDLSQLLSKMEEEFKKNKIENEALKDELTKL--TILSPNEDTS------EQTTQQLIE 551 Query: 409 IKVNFDVMKTENEDLQRKTKL----------LEEVTFSLKQKSFELD 519 ++ + +++ +N DL+ + K L+E SLKQK+ +LD Sbjct: 552 LQKHLQILQQKNMDLETQAKAGPGLELQLIQLQEELLSLKQKNTDLD 598 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/80 (22%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS--CSNERDILKANLSVKTLEYDEIKVN 420 ++H+KM+ +++ +KDK L ++ + + +S S D+ + T DE+ Sbjct: 1203 QEHQKMQEKYSKVKDKLLSTKQKWREDHQKLESLLTSPRVDMGLQTSIIDTSVVDEVSSQ 1262 Query: 421 FDVMKTENEDLQRKTKLLEE 480 + + NE L+ + K +E Sbjct: 1263 LSMSRQRNEKLEEELKDTKE 1282 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 32.3 bits (70), Expect = 0.25 Identities = 21/96 (21%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = +1 Query: 175 VEKRSTVAPKIPPYDFKARFN-DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCS 351 ++K V + P N + LE KK+K E KDK ++D +++ S S Sbjct: 3423 LDKAEPVLGSLEPVSGDVNKNKEELENVKKLKEELEGAKDKLNSLNDAERVLEDALTSVS 3482 Query: 352 NERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQR 459 + ++ L+ T +Y ++ ++ E+L++ Sbjct: 3483 GDPSTVQEELAAVTQKYHDL---LNIANAREEELEK 3515 Score = 31.1 bits (67), Expect = 0.58 Identities = 19/91 (20%), Positives = 42/91 (46%), Gaps = 1/91 (1%) Frame = +1 Query: 244 LEKHKKMKSEFTD-LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L+KH + E D ++D+ ++ + + +SC ++ I++ + YD++ Sbjct: 2492 LDKHLRTLKELDDEVEDRKPDLQTLNDTTADLIESCEADKYIIEGDAQDFNKRYDKLSAG 2551 Query: 421 FDVMKTENEDLQRKTKLLEEVTFSLKQKSFE 513 D +K + ED + E+ S QK+ + Sbjct: 2552 IDHLKKKVEDTKAAVDKYED-ALSPVQKALD 2581 Score = 31.1 bits (67), Expect = 0.58 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L +K ++++ F KDK E + EK++ Q E DI++A +E E +V+ Sbjct: 2866 LQDKISELEAGFGSAKDKAAERQGKLEKVEPEAQQFRQEADIIRA-----LIEDAEKQVH 2920 Query: 421 -FDVMKTENEDLQRKTKLLEEVTFS 492 F+ + ++ + ++ LLE++ S Sbjct: 2921 AFEPLSSDLAQIAKQRDLLEQIKAS 2945 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 31.9 bits (69), Expect = 0.33 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 7/94 (7%) Frame = +1 Query: 244 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKET-------FQSCSNERDILKANLSVKTLEY 402 L + + TDL+ ++ + +E+ ++KET F+ +E L L KT E Sbjct: 556 LNSESQHYQQLTDLQQQNASLHEEFSQLKETCDTLNSSFEEKDHELVDLTERLREKTREV 615 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 + + + K+ LQ K + LE LKQK Sbjct: 616 ESLTTQLEEAKSA---LQSKKQELENTLNELKQK 646 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 31.5 bits (68), Expect = 0.44 Identities = 16/70 (22%), Positives = 32/70 (45%) Frame = +1 Query: 310 DEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTF 489 +E E+++ +N + L+ L + +++ +K+E ++LQRK L Sbjct: 1690 EEEERLEAEIAELANTVETLRTELEQSQVRLSKLQTQVKELKSEKKELQRKVDELTSEAQ 1749 Query: 490 SLKQKSFELD 519 + SFE D Sbjct: 1750 RRRNLSFEAD 1759 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL--EYDE 408 +D LE +K++ + ++ ++++ SDE ++KE QS + E K+ + +L E D Sbjct: 1819 SDALENFEKLRVKLSEAQNQNATFSDEMARLKE--QSSAMEVRCSKSEEDIASLREEKDM 1876 Query: 409 IKVNFDVMKT 438 + F+ ++T Sbjct: 1877 LTTMFNELET 1886 Score = 27.9 bits (59), Expect = 5.4 Identities = 23/84 (27%), Positives = 41/84 (48%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTE 441 ++ + +L+ +E SDE E I++ + ++RD+ N S++ K +V E Sbjct: 1083 LQLQVRELERCKIEASDEIENIRKEMANAVSQRDL--KNESLRNRAEQAEKELEEVFGRE 1140 Query: 442 NEDLQRKTKLLEEVTFSLKQKSFE 513 E LQ + +EV + L QK E Sbjct: 1141 QELLQSHGQKEDEVVY-LTQKMEE 1163 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L +K ++ LK+K + D ++ + + E L+ + KTLE +E+K Sbjct: 1157 LTQKMEEAGQSAVQLKEKCETLGDTIKQKCDEVSALEEEVRSLRDAVQTKTLEMEEMKAF 1216 Query: 421 FDVMKTENEDL 453 FD + ++L Sbjct: 1217 FDSNNADLDEL 1227 >SB_8393| Best HMM Match : DUF662 (HMM E-Value=3.9e-26) Length = 319 Score = 31.5 bits (68), Expect = 0.44 Identities = 24/94 (25%), Positives = 43/94 (45%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 N+L + ++ L+DK E + ++ + ++ ++ E K +L KT + + Sbjct: 183 NELSHLDTLLSADVAILRDKIEEAARDFAQAQKRYERAEKEFVESKLDLHRKTERKEMLT 242 Query: 415 VNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 + + ENE QRK K LEE+ L EL Sbjct: 243 EHLYAIIQENE--QRKAKKLEELMAKLNVPKAEL 274 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 31.5 bits (68), Expect = 0.44 Identities = 22/95 (23%), Positives = 48/95 (50%) Frame = +1 Query: 220 FKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLE 399 ++ R ++L EK++ + +L+D+ V +I+ +SC +E KA+L+V+ + Sbjct: 2568 YQKRISELEEKYEHARELNVELEDELTVVQHRITEIENDNKSCQHE----KASLAVEITK 2623 Query: 400 YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 V F+ + ED +R+ + L + ++ K Sbjct: 2624 LRNQNVRFE---KQREDCEREKEHLRQQVSLMRSK 2655 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = +1 Query: 235 NDLLEKHKK---MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYD 405 ND+ E + K ++ + ++ D LE + ++ Q +E + LK ++ K Sbjct: 568 NDVREVNTKNDILEDQAKEMHDDLLEANKRAADAEDELQQTEDELNRLKNDIQEKEKRIS 627 Query: 406 EIKVNFDVMKTENEDLQRK 462 E++ FD E DL+++ Sbjct: 628 ELESAFDAADKEKRDLEQQ 646 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/73 (23%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +1 Query: 115 RIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPY-DFKARFNDLLEKHKKMKSEFTDLKD 291 +++R A + N K + S +A P D + + D E++ ++K E DL++ Sbjct: 2279 KLRRDLAALRNEMDNMNAEKRDHMSELARAQPQIADLENKLQDAREQNSRLKIEIDDLRN 2338 Query: 292 KHLEVSDEYEKIK 330 K YE+++ Sbjct: 2339 KLSSAKSRYERVE 2351 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/101 (16%), Positives = 45/101 (44%), Gaps = 1/101 (0%) Frame = +1 Query: 214 YDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT 393 Y+ + + +K +MK E K+++ ++ +Y K+++ ++ + N ++ Sbjct: 1201 YEIETLYKASQDKENRMKQELQSYKNRYEKLESDYRKLQQ--ENVDLRAKVNALNKRIRD 1258 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTKLLE-EVTFSLKQKSFE 513 LE + + + + E +Q L + E+ QK ++ Sbjct: 1259 LEAAKDRAEKEKQAIKEELVQANNDLADLEIEHDTVQKDYD 1299 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/93 (22%), Positives = 39/93 (41%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKV 417 DL K + DL+ E + IKE +N+ L+ +E+D ++ Sbjct: 1244 DLRAKVNALNKRIRDLEAAKDRAEKEKQAIKEELVQANND-------LADLEIEHDTVQK 1296 Query: 418 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 ++D +K + D + E +L+Q+ EL Sbjct: 1297 DYDSLKKQLADANERLAKAREENMNLQQQIVEL 1329 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/103 (21%), Positives = 47/103 (45%), Gaps = 2/103 (1%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 + K++ + ++ + DLK K E+ + + +K+ + E D A ++ + Sbjct: 1468 ELKSKIDYYNQEIESRDKTIEDLKLKRDELERQMDALKKDMRRV--EADYETAIQKIENM 1525 Query: 397 EYDEIKVNFDVMKTE--NEDLQRKTKLLEEVTFSLKQKSFELD 519 E VN ++ E N+ + K +EE +LK++ E+D Sbjct: 1526 EKANRSVNEKILIIEKSNDRDRENAKRMEEENINLKRRVAEMD 1568 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 31.5 bits (68), Expect = 0.44 Identities = 20/95 (21%), Positives = 49/95 (51%), Gaps = 1/95 (1%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 N+L+ + + + +L +++ +++ ++ + Q NE++ L+A L K +++ Sbjct: 1061 NELITSIHEKQQVYEELSEENRSLAEHVQESERLLQDLRNEKENLRALLESK----EQLV 1116 Query: 415 VNF-DVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 +++ + MK +D + L+EE L +K EL Sbjct: 1117 MSYSEEMKNLTKDNNELSVLVEEYQVKLHEKDKEL 1151 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 5/83 (6%) Frame = +1 Query: 286 KDKHL-EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 ++ H+ E+S+E +KE Q ERD L + T E ++ + +K + L Sbjct: 267 QESHMAEMSNEINSLKEELQQLGAERDELVGVRNKLTEEEARLRASLHEVKEDVNLLSAS 326 Query: 463 T-KLLEEVTFS---LKQKSFELD 519 T +L+EE+ S K++ FE++ Sbjct: 327 TLELMEELEHSQGVQKEQCFEIN 349 >SB_20371| Best HMM Match : U-box (HMM E-Value=0.075) Length = 515 Score = 31.5 bits (68), Expect = 0.44 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 2/94 (2%) Frame = +1 Query: 244 LEKHKKMKSEFTDLKDK-HLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 LE+ K +DK + + E EK ++ +R + K Y+E++ Sbjct: 60 LERALKDTRRLLFQRDKDNATLRQELEKTRKDINKEQAQRKRVVEGCEEKLKTYNEVQRR 119 Query: 421 FDVMKTENEDLQ-RKTKLLEEVTFSLKQKSFELD 519 + KTENE L KL E+V +++K E D Sbjct: 120 CEQFKTENEQLNVEMEKLKEKVKSLVREKGIEDD 153 >SB_56032| Best HMM Match : zf-CCHC (HMM E-Value=0.00047) Length = 632 Score = 31.1 bits (67), Expect = 0.58 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 2/75 (2%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERD-ILKANLSVKTLEYDEIK 414 DLL + K MK + LKD++ + DE +T + E+D ++ + V E ++ Sbjct: 53 DLLYELKVMKDKNERLKDRNTRLKDEQLMHIKTLLKQAKEKDKEVEKAVEVNHEEVEKAL 112 Query: 415 VN-FDVMKTENEDLQ 456 ++ FD++K+E +LQ Sbjct: 113 LSKFDLIKSEERELQ 127 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 355 ERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQ-RKTKLLEEVTFSLK 498 E IL + +K +++ VMK +NE L+ R T+L +E +K Sbjct: 36 EEAILSFQIEIKERAMEDLLYELKVMKDKNERLKDRNTRLKDEQLMHIK 84 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 30.7 bits (66), Expect = 0.76 Identities = 24/86 (27%), Positives = 41/86 (47%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 EK +++ + T L+ + E S E EK+K+T Q + + LK K+ E D+++ + Sbjct: 1339 EKVQELLHKVTYLEGELKERSVETEKLKQTLQEREEQIERLKEEFQEKSRELDKMRKEVE 1398 Query: 427 VMKTENEDLQRKTKLLEEVTFSLKQK 504 E LQ + E LK+K Sbjct: 1399 GGGALVETLQELLRERCEEVDVLKEK 1424 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 313 EYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENED 450 E E+ ++ FQ+ ERD L A +S + DE+ D ++ E+ + Sbjct: 14 ELERKQQEFQTIKEERDGLLAEVSQLKKQIDELVSEKDKLQAEHAE 59 >SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 30.7 bits (66), Expect = 0.76 Identities = 20/77 (25%), Positives = 42/77 (54%) Frame = +1 Query: 220 FKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLE 399 F R D ++ +++++++ + K H E + E+EK+K + I KA +SV+ + Sbjct: 29 FLTRKEDEMQTKEEIETKYENNKTVHGESNLEFEKVK-------SNAPIDKAEISVELKK 81 Query: 400 YDEIKVNFDVMKTENED 450 DE++ ++D + T D Sbjct: 82 RDEVERDYDRLFTRFPD 98 >SB_55835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/82 (13%), Positives = 36/82 (43%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 D ND+ + M + D+ +H++++ + + + RD + + + Sbjct: 26 DINMSHNDMNMRRDNMNTRHNDMNMRHIDMNMRRDNMNTRHNDMNMRRDNMNMRHNDMNM 85 Query: 397 EYDEIKVNFDVMKTENEDLQRK 462 ++++ + ++ M T + D+ + Sbjct: 86 RHNDMNMRYNDMNTRHNDMNMR 107 >SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) Length = 739 Score = 30.3 bits (65), Expect = 1.0 Identities = 25/89 (28%), Positives = 42/89 (47%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKV 417 D L + KKM EF LK V D+ +++ ++ ERDI ++ + DEIK Sbjct: 108 DALRRSKKMIHEFVALK----AVLDQ---LRDKQRALRTERDICTKRINTLKTKEDEIKN 160 Query: 418 NFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 D + + E+++ K E LK++ Sbjct: 161 ILDEQRGKAEEVRALQKETESERALLKKE 189 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 30.3 bits (65), Expect = 1.0 Identities = 10/35 (28%), Positives = 25/35 (71%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 342 ++L ++ ++K E LK++H E++++ EK+K+ + Sbjct: 1939 EVLTENDRLKEENKTLKEEHTELAEQNEKLKDALE 1973 Score = 28.3 bits (60), Expect = 4.1 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Frame = +1 Query: 247 EKHKKMKSEF-TDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNF 423 E+ ++ EF LK+K E+ EK+ T + SNE + +Y+ +K +F Sbjct: 524 EQQRRTNREFKARLKEKEKEIELLKEKLNTTIDTPSNETEHFDGGSG--NNKYEALKSDF 581 Query: 424 DVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 + + + E + TK+ + SL+Q+ EL Sbjct: 582 EEERLK-EYAKWSTKMALKNAQSLEQQRAEL 611 >SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) Length = 1083 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 3/93 (3%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKAN---LSVKTLEYDEIKV 417 EK+K ++ E DL+ E + ++ E+ L+ N L+VK + ++E+K Sbjct: 284 EKYKLLEKENADLRQSVSETQEVANSLQNRNSLLEREKQSLEENIQDLNVKQVVFEELK- 342 Query: 418 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 +V + E+ KT+ L V L + EL Sbjct: 343 --NVREEFAEESTTKTQYLNSVIAELTLANEEL 373 >SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) Length = 674 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 11/109 (10%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K R+ ++L+ ++ + + +++ V YE+++ + E+ L+ +S E Sbjct: 299 KDRYIEMLQAQRQRNGK--EQQEEVSTVQRNYERLESRLEVMKEEKSRLEETISTHRKEL 356 Query: 403 DEIK-------VNFDVMKTEN----EDLQRKTKLLEEVTFSLKQKSFEL 516 E+K V DVM+ +N DL++ EE+ L K E+ Sbjct: 357 IELKSSVKEKDVRLDVMEQKNARLERDLEKSVDSKEELASELSSKKLEV 405 >SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) Length = 390 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +1 Query: 100 SAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFT 279 +A R+KRS P+ + T VEK+ST AP K R ++H + Sbjct: 267 NAVIDRVKRSEPEPAPFNLKEPGTTVEKKSTAAPS------KERLVYRRDQHVPFRERLV 320 Query: 280 DLKDKHL 300 +D+H+ Sbjct: 321 YRRDQHV 327 >SB_6220| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0089) Length = 374 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/94 (24%), Positives = 40/94 (42%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 ++R +L + +K+K E K+K + E E++KE ++D L V+ E Sbjct: 92 QSRIEELQSRMEKLKRELKRQKEKESTLQGEKERLKEQLA----QKDSAINKLGVELKEL 147 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 EI+ D E +RK L++K Sbjct: 148 HEIEQKLDGKAEELAAEKRKATRATSEADKLREK 181 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 +DL++K K+ + TDL + + +S +IK S ERD + +Y + + Sbjct: 1547 DDLIDKQKQKERAETDLGEANKRISTLEMEIK----SLQTERDNALYERDLNNKDYIQQR 1602 Query: 415 VNFDVMKTENEDLQRKTK-LLEEVTFSLKQ 501 + ++ ENE + + K L ++ LK+ Sbjct: 1603 TDNQTLRQENETVLLENKDLKAQIAAGLKK 1632 >SB_47026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 61 TNHTRPLRNGPPVSAAAPRIK-RSATAPSS-TTIPNNVTKVEKRSTVAP 201 +N T NGP V + + AT PS+ TT+P+N T V T P Sbjct: 121 SNGTTVPYNGPTVPSNGATVPPNGATVPSNGTTVPSNGTTVPTNGTTVP 169 >SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) Length = 700 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS-CSN-ERDILKANLSVK 390 D + RF+ L K K M E T K+ ++ S E+E+ F+S CS +++ + N ++ Sbjct: 389 DQQKRFDTLWVKAKSMMDEETKHKENAIKRSKEFEERSHYFESQCSTLAKELEQRNNTII 448 Query: 391 TLE 399 LE Sbjct: 449 MLE 451 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/103 (19%), Positives = 47/103 (45%), Gaps = 1/103 (0%) Frame = +1 Query: 148 TTIPNNVTKVEKRSTVAPKIPPYD-FKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEK 324 T+I +N + + Y K + ++L + + ++ +DL +K+ VS E + Sbjct: 187 TSINSNTNNNNNNNNTRERSKDYQRLKHEYVNVLTELQILRQRNSDLNEKYDVVSQEADY 246 Query: 325 IKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDL 453 ++ ++ N+ D+L +Y+E + MK + E++ Sbjct: 247 FRKQHRTVLNKCDLLVREAQSLQRKYEESLREQEKMKQDYEEI 289 >SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/74 (25%), Positives = 41/74 (55%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 EK K++ +E +++ + E EK KET + E + LKA L ++L+ ++ ++ Sbjct: 27 EKEKQLLAESRAKEEEEKKRKREVEKKKETVEDVKIEIEKLKAKL--ESLKNEKHQMFLQ 84 Query: 427 VMKTENEDLQRKTK 468 + K +ED +++ + Sbjct: 85 LKKVLSEDEEKRQR 98 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/94 (14%), Positives = 44/94 (46%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 K L K +S+ L+ + + E+++++ + +++ + ++++ EY Sbjct: 161 KKEMKSLTSTVAKKESQIQALQQETERLRSEFQRLETDIKERTDDLEQRRSSIEQNNKEY 220 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 E+K D + ++L R+ +E+ + +++ Sbjct: 221 SELKRKRDELTNTRKELWRQEAAMEQTINTAREE 254 >SB_29745| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.04) Length = 1481 Score = 29.5 bits (63), Expect = 1.8 Identities = 28/128 (21%), Positives = 58/128 (45%) Frame = +1 Query: 121 KRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHL 300 ++++T +PNN + + S+ + K D + + ++ K+K+E DL + Sbjct: 647 QQNSTVERHEILPNNSRENDSSSSDSFKDAVVDLETQLIAKDQEILKLKNEVVDLMSEVG 706 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEE 480 ++ EY ++ SC +R L+ LS + DE++ + E L++ + + E Sbjct: 707 KLDGEYNEL-----SC--KRTQLEKELSDYRVAKDEVEGELQHILKECSQLKKDSAVYME 759 Query: 481 VTFSLKQK 504 LK K Sbjct: 760 ENKKLKDK 767 >SB_24402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 229 RFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLS 384 +F +L+ K + F+DL K E+ DE+ ET +S ++L LS Sbjct: 184 QFQAMLQTQKSLGDTFSDLGMKSPELQDEFNYNAETQKSLIKNGEVLLGALS 235 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 29.5 bits (63), Expect = 1.8 Identities = 25/103 (24%), Positives = 52/103 (50%), Gaps = 6/103 (5%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKD--KHLEVSDE-YEKIKETFQSCSNE-RDILKANLS 384 D + + L+K K LKD K+LE+ + YEK+KE F + E +D+ K + + Sbjct: 386 DVSTKRKNSLDKRAAAKKMDKQLKDATKNLELEKKKYEKVKEQFTTTEQELKDLKKEHDA 445 Query: 385 VKT-LEYDEIKV-NFDVMKTENEDLQRKTKLLEEVTFSLKQKS 507 +++ + D+ ++ D+ E K + L + +L++++ Sbjct: 446 LQSESKKDKAELAKLDIAAQEGLAAMEKVEELNKEVIALREEN 488 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 5/83 (6%) Frame = +1 Query: 286 KDKHL-EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 ++ H+ E+S+E +KE Q ERD L + T E ++ + +K + L Sbjct: 215 QESHMAEMSNEINSLKEELQQLGAERDELVGVRNKLTEEEARLRASLHEVKEDVNLLSAS 274 Query: 463 T-KLLEEVTFS---LKQKSFELD 519 T +L+EE+ S K++ FE++ Sbjct: 275 TLELMEELEHSQGVQKEQCFEIN 297 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/96 (23%), Positives = 50/96 (52%), Gaps = 4/96 (4%) Frame = +1 Query: 226 ARFNDLLEKHKKMKSEFTDLKDKHLEVSD----EYEKIKETFQSCSNERDILKANLSVKT 393 A F L ++ ++++ +L DK L V++ + +++ + Q+ +E + L K Sbjct: 1067 AEFEGLKKRLLELQAREAELTDK-LAVAENTAKDLDEVNASLQARLSELQAVNNELEEKL 1125 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 ++ + + +K+ENE LQ+K LE+ ++KQ Sbjct: 1126 MDLSRVG---EELKSENEGLQQKCLDLEKQRDTIKQ 1158 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/95 (20%), Positives = 47/95 (49%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 + ++EK+K+++ L+ + + ++E E ++ L ++ +E++ Sbjct: 573 SSIMEKNKEIEEL---LRTRESDNDQLQTTLREHNIELETELADMELELQKSAMKCEELE 629 Query: 415 VNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 DV ++EN+DL+++ K E L++ E+D Sbjct: 630 ALLDVRESENQDLEKRVK---ESISELEKSKLEVD 661 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 29.1 bits (62), Expect = 2.3 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%) Frame = +1 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK-VNF-DVMKTENEDLQRKTKLL 474 ++ +++ + KE Q C NERD L+ K + D++ + D +K LQR+ LL Sbjct: 1699 KLEEQFRREKE--QLC-NERDDLQVKYD-KLYQADQVDDARYEDTIKDLKNKLQRQVFLL 1754 Query: 475 EE--VTFSLKQKSFE 513 EE + FS KQ+ E Sbjct: 1755 EEKQMEFSAKQRKLE 1769 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/76 (23%), Positives = 36/76 (47%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 LLE+ K ++ + L + E Y++ + + +ERDIL ++ K ++ Sbjct: 1386 LLEREKSIQDKKNGLAEFEKEKVAIYQRFNDRIAAVESERDILVSDYQKK---ISSLRSE 1442 Query: 421 FDVMKTENEDLQRKTK 468 ++ E++ RKTK Sbjct: 1443 MVSLEESYENILRKTK 1458 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIK 330 +FK R++ L ++ + +F D+K+K ++ + E IK Sbjct: 692 NFKERYSQLQNNYEILMEQFGDVKEKSEMLAQDMESIK 729 >SB_9721| Best HMM Match : Filament (HMM E-Value=0.2) Length = 216 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMK 435 K++K +L D+ ++ D+YEK+ +S ++ L A E DE+K D ++ Sbjct: 90 KQLKQAKLEL-DQANKIKDDYEKLNSKTKSLEDKIIYLDATKRQLPKEKDELKSRVDHLE 148 Query: 436 TENEDLQ-RKTKLLEE 480 D + K KL E Sbjct: 149 DSIGDFETEKAKLFTE 164 >SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) Length = 393 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Frame = +1 Query: 271 EFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDV-MKTENE 447 E +L+D ++ DE EKI + +++ E +I A + + E++ V V T E Sbjct: 110 ELEELRDDIEKLKDESEKILDNYRAIMEEAEIRNAEIKKVSYEFERDLVKGAVNQDTLIE 169 Query: 448 DLQRKTKLLE----EVTFSLKQK 504 L+ K L+ ++ LKQK Sbjct: 170 KLRLKNSTLKVQKRKLHMQLKQK 192 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/67 (22%), Positives = 32/67 (47%) Frame = +1 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEE 480 E+S E+EK++ + N ++ + + + +E+K D+ E L+R L E Sbjct: 269 EISVEFEKMRNESANLQNLHELRRLDEELIQRRKEELKHARDIRMHYEEKLERANSLYHE 328 Query: 481 VTFSLKQ 501 + ++Q Sbjct: 329 LNLCMEQ 335 >SB_45619| Best HMM Match : M (HMM E-Value=0.01) Length = 1315 Score = 29.1 bits (62), Expect = 2.3 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 11/125 (8%) Frame = +1 Query: 178 EKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTD-LKDKHLEVSDEYEKIKETFQSCSN 354 E+ + + ++ D + D+ K +K +S + L D L+++DE IK + N Sbjct: 519 EEGAALYSQLQQDDNEKTLQDVNNKTEKERSGLENQLADLKLQLADEKSTIKALRKQQEN 578 Query: 355 ERDILKANLS-VKTLEYD---------EIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 ERD ++ S V L D +K D K + E Q + LEE SL++ Sbjct: 579 ERDTIERLTSDVNNLTEDNARLRKRCENLKEEHDATKEKMEMTQMRVSQLEE---SLRRS 635 Query: 505 SFELD 519 + L+ Sbjct: 636 QYALE 640 >SB_43708| Best HMM Match : TPR_2 (HMM E-Value=0.011) Length = 270 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/86 (15%), Positives = 42/86 (48%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 L + HK ++ L+D H+ + + +E +++T ++ + + L+ ++ ++ Sbjct: 94 LRDTHKALRDTHEVLRDTHVALRNTHEALRDTHEALRDTHEALRDTHEALRDTHEALRDT 153 Query: 421 FDVMKTENEDLQRKTKLLEEVTFSLK 498 + ++ +E L+ + L + +L+ Sbjct: 154 HEALRDTHEALRDTHEALRDTHEALR 179 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 29.1 bits (62), Expect = 2.3 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 1/110 (0%) Frame = +1 Query: 157 PNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVS-DEYEKIKE 333 P K +RS V K+ D+K LL + +K+ SE +K LE S DE KI++ Sbjct: 530 PQESVKDIERSEVYQKLAT-DYKNTEKALLIEQEKL-SEM----EKELENSKDEKVKIEQ 583 Query: 334 TFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEV 483 + LK N + +E +E+K N + ++ EN+ L+ + + +E+ Sbjct: 584 EKADLDIAIENLKRN---QEIELEELKDNIEDLERENKKLKGEIECNDEM 630 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.1 bits (62), Expect = 2.3 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 10/102 (9%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEK----------IKETFQSCSNERDILKANLSVK 390 L E+ ++K+E +DK E ++EK I E F S + D LK + + Sbjct: 2323 LEEERNQLKNELRLSEDKLHEAEQKFEKLEVALSQLESISEVFHSGTENVDALKKEIRDR 2382 Query: 391 TLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 E+ + ++ +N +Q + K +E LK++S L Sbjct: 2383 DKSIGELTEKIETLEKDNSSVQSEYKETKE---KLKKRSSSL 2421 Score = 27.9 bits (59), Expect = 5.4 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 7/111 (6%) Frame = +1 Query: 172 KVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEY-------EKIK 330 K E ST + D D L K+ E DLKD E +DE E + Sbjct: 798 KRENSSTRDKLVKANDLAQTLQDCL---KEAHDEKEDLKDSLEEANDEKIVAKKHSELLD 854 Query: 331 ETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEV 483 + + +RD LK + + DE+K + K E E L+ K+L+++ Sbjct: 855 GRLKEVTQQRDALKTEIESLKADDDELKAKCE--KAE-EKLKEIHKMLDDI 902 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +1 Query: 280 DLKDKHL-EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENED-L 453 +LK+KH E +D ++ Q+ + + + KA + + LE E+K D + ENED L Sbjct: 4475 ELKEKHYKEYADCLNQLTPE-QAEEHRKSVEKAMAAARELE--EVKKKLDEQRAENEDKL 4531 Query: 454 QRKTKLLEE 480 +++ + EE Sbjct: 4532 RQQNQEFEE 4540 >SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1102 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNN 165 PP+ A++P + S T+PSS P++ Sbjct: 997 PPIDASSPMMSSSVTSPSSPVTPSD 1021 >SB_45938| Best HMM Match : Troponin (HMM E-Value=1) Length = 185 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +1 Query: 232 FNDLLEKHKK-MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 408 +ND LE ++ M+ + D+K K E++++ S E+D +K + + + E Sbjct: 73 YNDQLESEREDMEYKVKDIKKKLSNERQRVEELEDELTSKKFEKDSIKQEVELLSATLSE 132 Query: 409 IKVNFDVMKTENEDLQRKTKLLEEVT 486 + E E+L+ K L+E T Sbjct: 133 TDEQQAMGMNERENLR---KALQEAT 155 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/95 (22%), Positives = 45/95 (47%), Gaps = 2/95 (2%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDI--LKANLSVKTL 396 K+ ++ K K+K + +++ E E+ K+ +S S E+ I L+AN+ Sbjct: 829 KSELDEEKAKATKLKKDMQAAQNEAAEARRTLERFKK--ESVSKEKTIMDLRANIETMEG 886 Query: 397 EYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 ++D + ++T E L+ + + L E ++Q Sbjct: 887 KFDPFYEEVNKLQTRIEILEDEKQALHEEALRIQQ 921 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/69 (20%), Positives = 36/69 (52%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMK 435 ++ S+ TD++ + ++ ++++ NER+ L LS + +++K + ++ Sbjct: 186 EESNSKLTDVRKELQGANNRVKELESVIADGVNERNDLNFKLSQSERQLEKMKASLRWIE 245 Query: 436 TENEDLQRK 462 EN LQ++ Sbjct: 246 KENAKLQKR 254 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/100 (21%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDI----LKANLS 384 D++ + LL+ KK+ +EF +L + E E + + Q N++DI LK L Sbjct: 373 DYQVDYKLLLDAKKKLDTEFEELSKN----NSEREAVLRSLQQEKNKKDIDLMTLKEKLR 428 Query: 385 VKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 E + K++ + + + + E ++Q+ Sbjct: 429 KSKAETEAAKMSCSTLSDQMNEYTKSVAQNGEDMLGIQQQ 468 >SB_11854| Best HMM Match : Neuromodulin (HMM E-Value=7.3) Length = 531 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 58 ITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNN 165 +T T P P + AP + TAP++TT PNN Sbjct: 36 LTTTTAPTTTTAPTTTTAPT---TTTAPTTTTTPNN 68 >SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) Length = 584 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +1 Query: 283 LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENE 447 +K+ HL E + ++E SNE++ L L K+++ ++K FD M T E Sbjct: 113 MKELHLS---EMKGMEEELTRLSNEKNQLCHELEKKSMDAAKMKEEFDAMATIRE 164 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 28.3 bits (60), Expect = 4.1 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 5/112 (4%) Frame = +1 Query: 199 PKIPPYDFKARFNDLLEKHKK-MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKA 375 P + Y + R + +EK K+ ++ + ++ + +DE +K+KE E+ L+ Sbjct: 33 PSLHLYQERHRHGEDIEKLKQEIEQKEREINNLRKTRNDEVKKLKERIHVLEEEKKRLEE 92 Query: 376 NL-SVK---TLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 L SVK T E+K + + E+ Q+ + L V ++ ELD Sbjct: 93 ELASVKYKLTALESEVKALSNANDRQEEEKQKLAEKLALVESKVQSFKEELD 144 >SB_27931| Best HMM Match : Filament (HMM E-Value=0.028) Length = 428 Score = 28.3 bits (60), Expect = 4.1 Identities = 23/115 (20%), Positives = 52/115 (45%), Gaps = 3/115 (2%) Frame = +1 Query: 145 STTIPNNVTKVEKRSTVAPKIPPYDFKARFND-LLEKHKK-MKSEFTDLKDKHLEVSDEY 318 + T+ N V ++R + + + D L+ K+ + E + + + + V E Sbjct: 314 AATVDNKVLLSQQREALQRERQAMSMRLAEQDRALDMAKQALVIEVEEERARLMAVDRER 373 Query: 319 EKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENE-DLQRKTKLLEE 480 K+KE +++ + + + L+ +E+K+N + E E + K ++LEE Sbjct: 374 SKLKEEIFKLQSDKKVAEGDKEKLKLKIEELKLNLEQTNKEKELVMGEKGQILEE 428 >SB_11461| Best HMM Match : NHL (HMM E-Value=0) Length = 819 Score = 28.3 bits (60), Expect = 4.1 Identities = 24/93 (25%), Positives = 46/93 (49%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 +L ++++ E + +D E+++E ++ + QS +NER + K DEI+ Sbjct: 114 ILRMIERLEVEISSSEDGETELTNETKQYEVHIQS-NNERLVQKE---------DEIQKL 163 Query: 421 FDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 + + N ++ + LE V F LK+ ELD Sbjct: 164 KETISGNNAVIESCGRKLETVRFFLKKSQVELD 196 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTV-APKIPP 213 PP+ A +KRS P P +++ R++ AP +PP Sbjct: 282 PPLKAGDSPLKRSVKKPLPPPPPQQAARIDYRASYGAPPLPP 323 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLE 249 PP+ A +KRS AP P ++++ R++ P +A DL E Sbjct: 229 PPLKAGDSPLKRSVKAPLPPPPPQQASRIDYRASYGAAPPAPSLQAVCIDLPE 281 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLE 249 PP+ A +KRS AP P ++++ R++ P +A DL E Sbjct: 370 PPLKAGDSPLKRSVKAPLPPPPPQQASRIDYRASYGAAPPAPSLQAVCIDLPE 422 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTV-APKIPP 213 PP+ A +KRS P P ++ R++ AP +PP Sbjct: 423 PPLKAGDSPLKRSVKKPLPPPPPQQAARINYRASYGAPPLPP 464 >SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) Length = 1559 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 37 DVDKKNLITNHTRPLRNGPPVSAAAPRIKR 126 D D + IT P N PPV+ AAP+ +R Sbjct: 26 DNDNTSYITPQAAPNTNPPPVATAAPQRRR 55 >SB_47479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 +FKA NDL K+++ + T D+ EK +F ER + KAN +K Sbjct: 16 EFKAEINDLRSLIKELEKKSTKANDELQSFQAAKEKASNSFFGIMRER-LKKAN-PMKYA 73 Query: 397 EYDEIKVNFDVM 432 D + ++ D++ Sbjct: 74 GTDRLHLDRDLL 85 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 2/90 (2%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 ++EK+K + +L K EV+D Y +++ + +R L N K + + + Sbjct: 633 IIEKNKDDPTTVDELTHKIQEVTDRYVAVEQKLR----DRAALIQNALYKRQNFQQALED 688 Query: 421 FD--VMKTENEDLQRKTKLLEEVTFSLKQK 504 F+ +++TE ++L + +L E + L+ + Sbjct: 689 FETWLVQTEEKELMEEIELHEPIHKDLQTR 718 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 28.3 bits (60), Expect = 4.1 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 9/99 (9%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYE---KIKETF---QSCSNER---DILKANLSVKTLE 399 +K +K ++E + + E S++ E K+K+ + N+R ++ K+ +K LE Sbjct: 123 KKFRKQQAEQAEAESSSSESSEDLEEKMKMKDKLLEDKYIENQRLEAEVWKSAERIKVLE 182 Query: 400 YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 +EI + + DLQ+K LEE+T LK L Sbjct: 183 -EEILWRAEKINALISDLQKKENSLEEMTELLKDTQTRL 220 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.3 bits (60), Expect = 4.1 Identities = 19/86 (22%), Positives = 43/86 (50%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 KA + +E+ +++ S + K + L+ E+I + S E+ I + ++ + Sbjct: 448 KAELHCQVEEERRLLSFYARRKTEDLQFKLAEEEIILGDELKSEEKQIQELQSKIRQ-QQ 506 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEE 480 ++++ ++ T + DL+ K K LEE Sbjct: 507 EQLEQQREITDTVSTDLEEKAKELEE 532 >SB_55202| Best HMM Match : FIVAR (HMM E-Value=3.7) Length = 145 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 433 KTENEDLQRKTKLLEEVTFSLKQKSFEL 516 K+ NE+LQ+ TK++ + +KQK+ E+ Sbjct: 23 KSLNENLQKATKMINAIDKQIKQKTKEI 50 >SB_37547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = +1 Query: 283 LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 LKD ++YE+ ++T + + D K+ + T N + MK E + Sbjct: 599 LKDDAKLAINQYERYRKTSEGLKHRIDATKSMTHIMTAIVRSNDFNIEAMKRELDKTIED 658 Query: 463 TKLLEE 480 KLL E Sbjct: 659 QKLLRE 664 >SB_33454| Best HMM Match : PAN (HMM E-Value=0.0013) Length = 459 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/108 (17%), Positives = 44/108 (40%) Frame = +1 Query: 142 SSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYE 321 ++T + NN T++ ST + D+ + + + TD+ + +E+++ Sbjct: 260 NTTEMTNNTTEITT-STTDMTDNTTEMTNSTTDMTDNTTDVTNSTTDMTNSSIEMTNSTT 318 Query: 322 KIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKT 465 + + +N +K+N + T ++K N M D+ T Sbjct: 319 DVTDNTTEMTNSTTDMKSNTTEMTNSTTDMKSNTTEMTNSTTDVTDNT 366 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 27.9 bits (59), Expect = 5.4 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 5/101 (4%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANL-SVKT 393 D K++ +LL K + + DL + E+ + + + + + E LK++ S Sbjct: 158 DLKSKL-ELLMKDQSGAAVIKDLTRQVEELRENLKAKQAILEDINRENQELKSHKGSTPN 216 Query: 394 LEY----DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 +Y +E+K N ++ K EDL R + L+ LK + Sbjct: 217 QDYVSMIEELKSNLEIKKAALEDLNRMNEHLDAENKQLKAR 257 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 27.9 bits (59), Expect = 5.4 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 8/96 (8%) Frame = +1 Query: 136 APSSTTIPNNVTKVEKR-----STVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHL 300 APS TT P N TKVE TV P + +R L + + LK ++L Sbjct: 1229 APSITTHPQNQTKVEGEIVTLSCTVTGDPVPTVYWSRDGSNLTALRYLVEPSNTLKIENL 1288 Query: 301 EVSDEYEKIKETF---QSCSNERDILKANLSVKTLE 399 DE I F S S++ +L N K LE Sbjct: 1289 TREDEGSYICHAFNNVSSTSSDAAVLTVNYPPKFLE 1324 >SB_53408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERD 363 +D++ HKK KSE +L D L EY+ ++ ++ + + Sbjct: 1 SDIMATHKKYKSEVNELHDALLLGKREYDLMRIEYEQSAKTNE 43 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKI----KETFQSCSNERDILKANLSVKTLEYDE 408 E KKM +E D+K K+ E+S E+E++ E + +R+ L+ ++ +Y++ Sbjct: 78 ELGKKMLAENDDIKMKYGELSREHEEVVKELDEEITRVTTDRNNLRTSMKTLQAKYEQ 135 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/65 (23%), Positives = 36/65 (55%), Gaps = 7/65 (10%) Frame = +1 Query: 220 FKARFNDLLEKHKKMKSE----FTDLK---DKHLEVSDEYEKIKETFQSCSNERDILKAN 378 ++++ D K + +++E TDL+ +K + + E + +KE ++ RD++++ Sbjct: 564 YRSQIQDNTSKIESLEAEKRAITTDLESSIEKRVSIEKELQSVKEQLETGYRSRDVVESE 623 Query: 379 LSVKT 393 L+V T Sbjct: 624 LAVAT 628 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/119 (15%), Positives = 50/119 (42%) Frame = +1 Query: 163 NVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 342 ++ +V K ++ +F + L K +M + + +++ + +++E Sbjct: 231 SLKEVAKEDEPLNQVTKDEFVTKMEKLRAKKDEMLKKIEEFEEREKAAMKKIARLEEVIA 290 Query: 343 SCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 NE L+ + S+ ++D+ + D L +KT+ ++ L+ + E+D Sbjct: 291 KDKNESATLRRSCSLTEHQFDKTEDILDQKLERLVMLHKKTEQDIQMLKVLEDRELEVD 349 >SB_11809| Best HMM Match : Rabaptin (HMM E-Value=0.8) Length = 1009 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHL-EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNF 423 E ++ E +LK L EV+D+ + + + F + + ++ L+AN+ + + D + Sbjct: 903 EAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLI 962 Query: 424 DVMKTENEDLQRKTKLLEEVTFSL 495 + E E +LLE+ F + Sbjct: 963 GGLGGEKERWTETARLLEDRFFKV 986 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = +1 Query: 229 RFNDLLEKHKKMKSEFTDLKDKHLE---VSDEYEKIKETFQSCSNERDILKANLSVKTLE 399 R ++ K K++ E L+++ E +E K +E + E ++ + + Sbjct: 613 RKKEIENKKKEIDDEMRKLEEERTERDRQKEEERKRREEEEKKKREDEVKREEEGRRQKV 672 Query: 400 YDEIKVNFDVMKTENEDLQRKTKLLEE 480 E+K+ D K E+L++KTK EE Sbjct: 673 EAELKLIEDEHKQRLEELEKKTKKEEE 699 >SB_2494| Best HMM Match : M (HMM E-Value=0.0056) Length = 737 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/92 (20%), Positives = 38/92 (41%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 ++R + L +K+ TDL + E K++ F+ +ERD + S+ + Sbjct: 258 RSRNSQLEASQSHVKTHATDLSTQLDEARSRIVKLELKFRPIIHERDEYRERTSLPDRKV 317 Query: 403 DEIKVNFDVMKTENEDLQRKTKLLEEVTFSLK 498 E+ N DL ++ L+ + L+ Sbjct: 318 SELSSLLQKADDNNNDLDQELSALKGQMWKLE 349 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 370 KANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLE 477 KA L T +E+K +D + E+L+ K +LLE Sbjct: 2578 KAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLE 2613 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = +1 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEE 480 E+ DEY++ + +SC N K L E KV DV KT + L+ + EE Sbjct: 718 EIEDEYQRFDKWRESCENMAQFTK---ECDRLTKQEDKVGSDV-KTLQKQLKDCQEFKEE 773 Query: 481 V 483 V Sbjct: 774 V 774 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +1 Query: 61 TNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPP 213 T +RPL PP P R T+ P N KR + P PP Sbjct: 234 TGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 >SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) Length = 633 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/71 (18%), Positives = 36/71 (50%) Frame = +1 Query: 265 KSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTEN 444 K++ +L+++ E + + I+ + ER+ L A L + + D ++ + + + Sbjct: 169 KTQVKELREEVDEKTKQVTDIESKVKQLKEERESLSAQLELTLTKADSEQLARSIAEEQY 228 Query: 445 EDLQRKTKLLE 477 DL+++ ++E Sbjct: 229 SDLEKEKTMIE 239 >SB_34845| Best HMM Match : CXC (HMM E-Value=0.03) Length = 1397 Score = 27.5 bits (58), Expect = 7.1 Identities = 29/138 (21%), Positives = 56/138 (40%), Gaps = 8/138 (5%) Frame = +1 Query: 124 RSATAPSSTTIPNNVTKVEKR--STVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKH 297 +S T I NVT + +T+ + ++ E K +K++FT++K K Sbjct: 677 KSTLCKGRTEIDKNVTLLSASVYNTMDSCVAMASNSEEITEITEMRKALKNKFTEMKAKA 736 Query: 298 LEVSDEYEKIKETFQSCSN--ERDILKANLSVKTLEYDEI----KVNFDVMKTENEDLQR 459 S ETF + ++ L + S+ L + ++ F + E E + Sbjct: 737 QFHSSRIGANAETFSTTTSLKTNSTLSSRRSLTELREKKAALRKRMEFATLIAEQESRLQ 796 Query: 460 KTKLLEEVTFSLKQKSFE 513 + KL +E+ Q+ F+ Sbjct: 797 QLKLCQELEEISAQEVFQ 814 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 27.5 bits (58), Expect = 7.1 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 14/99 (14%) Frame = +1 Query: 229 RFNDLLEKHKK---MKSEFTDLKDKHLEVSD----EYEKIKETFQSCSNERDILKANLSV 387 + +DL +++K+ +K +L ++++E+S + + E + C L+ L+ Sbjct: 70 QMDDLEDQYKEIEHLKEINEELNNRNVELSKADNVSFSRTDEEVEGCPGCAK-LRLELNA 128 Query: 388 KTLEYDEIK-------VNFDVMKTENEDLQRKTKLLEEV 483 EY+ K V + +K EN+D Q++TK L++V Sbjct: 129 LQEEYESQKIKIEELEVRIEDLKEENDDYQQETKYLKQV 167 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +1 Query: 61 TNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPP 213 T +RPL PP P R T+ P N KR + P PP Sbjct: 146 TGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 >SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 46 KKNLITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVT 171 + + IT+ T P P + P + T PS T+P++ T Sbjct: 379 RSHRITDRTGPTVPSDPTVPSDPTVPSDPTVPSDPTVPSDPT 420 >SB_58300| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 1736 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 3/88 (3%) Frame = +1 Query: 172 KVEKRSTVA--PKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDE-YEKIKETFQ 342 K+ KR++VA P +F+ +LEK + +++E L+ ++L+ S + EK+ Sbjct: 1562 KLAKRASVAAAPLAAWVRANVKFSVVLEKIEPLENEQAQLQ-RNLDKSQQRLEKLGRALD 1620 Query: 343 SCSNERDILKANLSVKTLEYDEIKVNFD 426 +E ++ ++T E ++K+ D Sbjct: 1621 KVDHEVAEMRNRFELRTKEATQLKMELD 1648 >SB_47001| Best HMM Match : Asparaginase_2 (HMM E-Value=2.5e-40) Length = 423 Score = 27.5 bits (58), Expect = 7.1 Identities = 19/69 (27%), Positives = 37/69 (53%) Frame = +1 Query: 277 TDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQ 456 T+++ K LE + E ++K+ + +NE+ L + + +E K +FD + + +LQ Sbjct: 195 TEMRRKQLEAALEALEVKKMEEKENNEK------LQKEKEDKEEDKKDFDCVNSFETELQ 248 Query: 457 RKTKLLEEV 483 K + EEV Sbjct: 249 SKPEKREEV 257 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/66 (24%), Positives = 29/66 (43%) Frame = +1 Query: 283 LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 LKD D+YE+ ++T + + D + + T N + MK E + + Sbjct: 566 LKDDAKLAIDQYERYRKTSEDLKHRIDATTSMTHIMTAIVRSNDFNIEAMKRELDKTIKD 625 Query: 463 TKLLEE 480 KLL++ Sbjct: 626 QKLLKD 631 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 27.5 bits (58), Expect = 7.1 Identities = 19/82 (23%), Positives = 39/82 (47%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 402 + R +L EK+ +++ + + +K EY+K KE + E ++ E Sbjct: 471 RVRETELSEKYHELEKQLRVISEKSENTKTEYDKSKE--KELLQEMLVVVEKREQLIAEM 528 Query: 403 DEIKVNFDVMKTENEDLQRKTK 468 DE K + E++DL+R+++ Sbjct: 529 DESKHRY---MDEDKDLERQSE 547 >SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/128 (16%), Positives = 50/128 (39%) Frame = +1 Query: 121 KRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHL 300 ++ A A N ++E+R K + + + N+L+EK+ + L++ Sbjct: 321 QQKALAEMEEMYNTNTAELEQRIQALEK-EAAETEQKLNELMEKYDFTLGDKNKLQEDFE 379 Query: 301 EVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEE 480 + E+++ Q + + K L E K + + + ++++K L+ Sbjct: 380 SMKKNKEEVEAALQQALKDLGLFKDELKTTCEELTSAKADSKAKQHKIHEMEKKRDELQV 439 Query: 481 VTFSLKQK 504 + L K Sbjct: 440 LVQCLTDK 447 >SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) Length = 1024 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/73 (19%), Positives = 34/73 (46%) Frame = +1 Query: 283 LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 L DK+LE+ +E + +++T RD+ + +++ D+ + + +RK Sbjct: 464 LTDKNLELEEEVQTLRDTVSDLEALRDLNEELEETHLQTEQDLREELDMTSNKVREAERK 523 Query: 463 TKLLEEVTFSLKQ 501 + ++ L+Q Sbjct: 524 YEQAQDSIGDLQQ 536 >SB_23812| Best HMM Match : Filament (HMM E-Value=0.05) Length = 307 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/80 (21%), Positives = 34/80 (42%) Frame = +1 Query: 262 MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTE 441 +K E L+ ++ + Y+K+ QSC E L+ L L + + T Sbjct: 32 LKVELEHLRKENTTAQNHYKKVLSELQSCRTENQELQGRLHQLELNSGMRDSDLRAVITS 91 Query: 442 NEDLQRKTKLLEEVTFSLKQ 501 ++ R+ + L T +L++ Sbjct: 92 RDEALREVEKLVHHTEALER 111 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/67 (25%), Positives = 30/67 (44%) Frame = +1 Query: 73 RPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEK 252 +P ++ VS+ KR+ P S +P +KR +AP +P Y ++ L Sbjct: 1539 KPAKDSAVVSSV---YKRTGARPKSRPLPWYPGMSQKREILAPPVPMYHHTQTYSGLNNP 1595 Query: 253 HKKMKSE 273 + KS+ Sbjct: 1596 AEYSKSQ 1602 >SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) Length = 1054 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +1 Query: 52 NLITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIP 210 N + T+P+ P + PR +++ + SS+ + VE +T+AP +P Sbjct: 397 NTASLKTKPIAIAPKTTRPTPRTEKAESVGSSS---GAIDPVEAPTTIAPLVP 446 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 27.5 bits (58), Expect = 7.1 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 14/99 (14%) Frame = +1 Query: 229 RFNDLLEKHKK---MKSEFTDLKDKHLEVSD----EYEKIKETFQSCSNERDILKANLSV 387 + +DL +++K+ +K +L ++++E+S + + E + C L+ L+ Sbjct: 807 QMDDLEDQYKEIEHLKEINEELNNRNVELSKADNVSFSRTDEEVEGCPGCAK-LRLELNA 865 Query: 388 KTLEYDEIK-------VNFDVMKTENEDLQRKTKLLEEV 483 EY+ K V + +K EN+D Q++TK L++V Sbjct: 866 LQEEYESQKIKIEELEVRIEDLKEENDDYQQETKYLKQV 904 >SB_4346| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 189 Score = 27.5 bits (58), Expect = 7.1 Identities = 25/83 (30%), Positives = 40/83 (48%) Frame = +1 Query: 229 RFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 408 R +LLEK+ K+ E DL D+ E+++ S R + + N + T EY+E Sbjct: 54 RCQELLEKNNKLVVEQHDLTDR-----STVEQLQ------SRLRSVEEQNRQI-TKEYEE 101 Query: 409 IKVNFDVMKTENEDLQRKTKLLE 477 K + +TE LQR+ +E Sbjct: 102 NKELLRLAETEKNILQREVGFIE 124 >SB_57183| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) Length = 533 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 127 SATAPSS---TTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHK 258 S T PSS TT+ + T +E+R AP P +R D + ++ Sbjct: 289 STTTPSSSTYTTVESRATTMERRPEAAPGYPGSRHSSRHEDERDSYR 335 >SB_50756| Best HMM Match : S-antigen (HMM E-Value=2.4e-09) Length = 712 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 11/88 (12%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDK--HLEVSDEYEKIKETFQSCSNERDILKANLSVKTL-------- 396 E K+ K+E +++K +LE S E + Q+C E + A + ++ L Sbjct: 583 ESLKEAKAENRAMREKLQYLEKSSE----EADLQACEIENQLKHAKMVIQQLKDQELEMA 638 Query: 397 -EYDEIKVNFDVMKTENEDLQRKTKLLE 477 + DE++ + + +K +N LQR E Sbjct: 639 KQIDELEQHIETLKQQNNSLQRNNSSFE 666 >SB_44119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 67 HTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKI 207 H LRNG VS +A S++ P+S T+ + + + + +P + Sbjct: 47 HLLELRNGGSVSTSASVTPSSSSGPTSPTLSSRNSIIGSENPTSPPL 93 >SB_29722| Best HMM Match : HLH (HMM E-Value=4.9e-14) Length = 106 Score = 27.1 bits (57), Expect = 9.4 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Frame = +1 Query: 67 HTRPLRNGPPVSAAAPRIKRSATAPSSTTI-----PNNVTK--VEKRSTVAPKIPPYDFK 225 HT PLR+ P PR + S PS+ I N+ K +E + T+ P +PP Sbjct: 4 HTIPLRHQPEEIFLKPRKRASYDQPSANAIRERIRAQNLKKAYMELQKTL-PNVPPDTKL 62 Query: 226 ARFNDLL 246 R N LL Sbjct: 63 PRLNILL 69 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 9/79 (11%) Frame = +1 Query: 214 YDFKARFNDLLEKH-KKMKSEFTDLKDKHLEVSDEYEKIKET------FQSCSNE--RDI 366 +D K + ++K +K TD K + + +K+ E+ F S N+ + I Sbjct: 463 FDIKTLLGETIDKELDNLKVNLTDQKILNNDSRQSLKKLNESGVDDINFDSFLNQTRKGI 522 Query: 367 LKANLSVKTLEYDEIKVNF 423 K+NL++ + DE+ NF Sbjct: 523 TKSNLTIFAAQLDELAKNF 541 >SB_7838| Best HMM Match : Filamin (HMM E-Value=1.1e-22) Length = 820 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +1 Query: 7 ISRTIANGLSDVDKKNLITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTI-PNNVTKVEK 183 +SRT ++ L +L+ + +++ PP ++++P I S A S + P ++T Sbjct: 655 LSRTNSDLLLHGSLNSLMASRESLVKSSPPGNSSSPGIPPSGPANSFPPVTPTSLTANSS 714 Query: 184 RSTVAPKIPPYDFKAR 231 S + P P F ++ Sbjct: 715 PSGIPPSPPDNAFMSK 730 >SB_46937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/78 (24%), Positives = 43/78 (55%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 ++ + ++S+ + L+ + E+ E I+ T ++ + ++L + LS +T E VN Sbjct: 366 QEKENLESDMSTLRSRLRELQ---EIIENTEKAAQSNTELLTSKLSTRTQE-----VN-- 415 Query: 427 VMKTENEDLQRKTKLLEE 480 ++TENE+L+ +E+ Sbjct: 416 ALRTENEELRADIAAMED 433 >SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1182 Score = 27.1 bits (57), Expect = 9.4 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 7/95 (7%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLK-------DKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT 393 +++LEK K+ + DLK +K L VSD + + + +N + + K + + Sbjct: 903 DEILEKTKQNLTRAEDLKRRAEEAREKALTVSDVIQNVTDALDMAANGQQLAKDAIQLAE 962 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLK 498 + E + D + + L++K E T +K Sbjct: 963 DDIVESQGILDALLPLLDALEKKVNAAENTTNQVK 997 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Frame = +1 Query: 283 LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTEN----ED 450 L+ + L E + KE E++ LKA + + I N+D TE E+ Sbjct: 289 LEAERLAKEKEEQLAKEKATQAKKEKEKLKAAMKKERKSIRAICKNYDYFVTEEAEKIEE 348 Query: 451 LQRKTKLLEEVT 486 +Q KLLE+++ Sbjct: 349 MQILDKLLEDLS 360 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 82 RNGPPVSA-AAPRIKRSATAPSSTTIP 159 R GPP S A PR + SATA SS P Sbjct: 421 RTGPPQSRQAVPRHRTSATADSSIPAP 447 >SB_15566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1265 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = +1 Query: 268 SEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT-LEYDEIKVNFDVMKTEN 444 S T K++H Y K ET QS ++D + S+K L D+++ + Sbjct: 583 SNDTSTKEEHHIHDQHYSKWYETHQSAELQKDAERVKESIKVELLDDDLRNEIKRCNSLR 642 Query: 445 EDLQR--KTKLLEEVTFSLKQK 504 ++L++ + ++ EE + L+++ Sbjct: 643 KELEQCDQLRITEEQSIDLRKE 664 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/98 (20%), Positives = 45/98 (45%), Gaps = 3/98 (3%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSD---EYEKIKETFQSCSNERDILKANLSVKTLEYD 405 ++L EK K+ + +LK +SD + + ++ + ERDI + + + Sbjct: 1624 DELNEKQKQKEKAEDNLKALKKRISDLEVDNKNLETARDNAVYERDIANQKFVEQRTDNE 1683 Query: 406 EIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 +K + + + +DLQ + LE LK+++ + + Sbjct: 1684 VLKEEKEKLLMQLKDLQNEVARLENQLEDLKKRNADYE 1721 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.311 0.128 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,800,835 Number of Sequences: 59808 Number of extensions: 196439 Number of successful extensions: 1021 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1005 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -