BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306D02f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) fa... 40 0.001 At3g19370.1 68416.m02457 expressed protein 36 0.017 At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr... 35 0.038 At3g22790.1 68416.m02873 kinase interacting family protein simil... 33 0.12 At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-... 33 0.15 At5g52280.1 68418.m06488 protein transport protein-related low s... 32 0.20 At5g15150.1 68418.m01775 homeobox-leucine zipper protein 7 (HAT7... 32 0.27 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 32 0.27 At1g17140.2 68414.m02089 tropomyosin-related similar to Tropomyo... 32 0.27 At1g17140.1 68414.m02088 tropomyosin-related similar to Tropomyo... 32 0.27 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 31 0.36 At1g03830.1 68414.m00364 guanylate-binding family protein contai... 31 0.36 At1g20530.1 68414.m02558 hypothetical protein 31 0.47 At2g42480.1 68415.m05255 meprin and TRAF homology domain-contain... 31 0.62 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 30 0.82 At5g45380.1 68418.m05577 sodium:solute symporter family protein ... 30 0.82 At4g31570.1 68417.m04483 expressed protein 30 0.82 At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zi... 30 0.82 At1g11690.1 68414.m01342 hypothetical protein 30 0.82 At1g26960.1 68414.m03287 homeobox-leucine zipper protein, putati... 30 1.1 At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR016... 30 1.1 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 1.4 At3g44050.1 68416.m04718 kinesin motor protein-related KLP2 prot... 29 1.4 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 29 1.4 At2g14045.2 68415.m01562 expressed protein 29 1.4 At2g14045.1 68415.m01561 expressed protein 29 1.4 At1g76740.1 68414.m08931 expressed protein weak similarity to fi... 29 1.4 At1g54450.1 68414.m06211 calcium-binding EF-hand family protein ... 29 1.4 At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:4... 29 1.4 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 29 1.4 At5g02210.1 68418.m00142 expressed protein ; expression supporte... 29 1.9 At3g59200.1 68416.m06600 F-box family protein contains F-box dom... 29 1.9 At1g68790.1 68414.m07863 expressed protein 29 1.9 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 29 2.5 At3g52115.1 68416.m05720 hypothetical protein 29 2.5 At3g48860.2 68416.m05337 expressed protein 29 2.5 At3g48860.1 68416.m05336 expressed protein 29 2.5 At3g12930.1 68416.m01611 expressed protein contains Pfam domain ... 29 2.5 At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative... 29 2.5 At5g53800.1 68418.m06685 expressed protein 28 3.3 At5g27330.1 68418.m03263 expressed protein 28 3.3 At5g13950.1 68418.m01631 expressed protein 28 3.3 At5g07890.1 68418.m00910 myosin heavy chain-related contains wea... 28 3.3 At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related... 28 3.3 At3g22860.1 68416.m02882 eukaryotic translation initiation facto... 28 3.3 At3g13222.1 68416.m01655 expressed protein 28 3.3 At2g37080.1 68415.m04550 myosin heavy chain-related low similari... 28 3.3 At1g65280.1 68414.m07402 DNAJ heat shock N-terminal domain-conta... 28 3.3 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 28 3.3 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 28 4.4 At5g56160.1 68418.m07006 SEC14 cytosolic factor family protein /... 28 4.4 At5g41140.1 68418.m05001 expressed protein 28 4.4 At5g16620.1 68418.m01946 hydroxyproline-rich glycoprotein family... 28 4.4 At5g07660.1 68418.m00877 structural maintenance of chromosomes (... 28 4.4 At4g29440.1 68417.m04203 expressed protein contains Pfam profil... 28 4.4 At4g15030.1 68417.m02309 expressed protein 28 4.4 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 28 4.4 At1g66180.1 68414.m07512 aspartyl protease family protein contai... 28 4.4 At1g21695.1 68414.m02716 hydroxyproline-rich glycoprotein family... 28 4.4 At1g09720.1 68414.m01091 kinase interacting family protein simil... 28 4.4 At5g65310.1 68418.m08216 homeobox-leucine zipper protein 5 (HB-5... 27 5.8 At5g60580.3 68418.m07597 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At5g60580.2 68418.m07596 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At5g60580.1 68418.m07595 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 27 5.8 At5g45310.1 68418.m05562 expressed protein 27 5.8 At5g41780.1 68418.m05087 myosin heavy chain-related weak similar... 27 5.8 At5g18940.1 68418.m02249 Mo25 family protein similar to SP|Q0613... 27 5.8 At5g15040.1 68418.m01763 paired amphipathic helix repeat-contain... 27 5.8 At2g46240.1 68415.m05750 IQ domain-containing protein / BAG doma... 27 5.8 At2g22430.1 68415.m02660 homeobox-leucine zipper protein 6 (HB-6... 27 5.8 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 27 5.8 At1g69060.1 68414.m07902 expressed protein 27 5.8 At1g59540.1 68414.m06694 kinesin motor protein-related similar t... 27 5.8 At1g21810.1 68414.m02729 expressed protein 27 5.8 At5g55490.1 68418.m06911 expressed protein 27 7.7 At3g58410.1 68416.m06510 meprin and TRAF homology domain-contain... 27 7.7 At3g54870.1 68416.m06079 armadillo/beta-catenin repeat family pr... 27 7.7 At2g24650.1 68415.m02944 transcriptional factor B3 family protei... 27 7.7 At1g22060.1 68414.m02759 expressed protein 27 7.7 At1g04260.1 68414.m00417 prenylated rab acceptor (PRA1) family p... 27 7.7 >At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 383 Score = 39.9 bits (89), Expect = 0.001 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 2/102 (1%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDL--KDKHLEVSDEYEKIKETFQSCSNERDILKANLSVK 390 +FKAR E+ K SE L +D+HL +S E K E LK+ +S Sbjct: 207 NFKARIAHNEEQMKGCFSEAYKLIQEDRHLVIS--LETTKWEVADADKEFRWLKSAVSSS 264 Query: 391 TLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 EY++I D +K E +D +R+ K LEE L ++ EL Sbjct: 265 EKEYEQISRRTDDIKLELDDERREKKKLEEELMELNKELEEL 306 >At3g19370.1 68416.m02457 expressed protein Length = 704 Score = 35.9 bits (79), Expect = 0.017 Identities = 18/80 (22%), Positives = 41/80 (51%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 + + + + +EK + +++E L++ +V E E K + + +I +ANL+ Sbjct: 485 ELRKKLEESVEKIRNLEAEMKTLRENKEKVEAEMETEKSMKEDLDTKLNITRANLNETQK 544 Query: 397 EYDEIKVNFDVMKTENEDLQ 456 + ++V FD K+ E+L+ Sbjct: 545 KLSSLEVEFDYRKSCCEELE 564 >At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 284 Score = 34.7 bits (76), Expect = 0.038 Identities = 18/78 (23%), Positives = 38/78 (48%) Frame = +1 Query: 175 VEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSN 354 VE + + P+ P D D ++ K++ SE LK ++ ++DE ++ + Sbjct: 26 VELGNVLDPERPKNDKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQEKNDLRE 85 Query: 355 ERDILKANLSVKTLEYDE 408 E+ LK+++ L+Y + Sbjct: 86 EKTSLKSDIENLNLQYQQ 103 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 33.1 bits (72), Expect = 0.12 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 8/91 (8%) Frame = +1 Query: 238 DLLEKHKKMKSEFTDLKDKHLEVSDE-------YEKIKETFQSCSNE-RDILKANLSVKT 393 +LLE ++++KSE D + + LE+ E +E + E++ + + D L N S+ Sbjct: 989 ELLEMNRQLKSELIDREQRELELKAELQTEHLKFENLHESYMALHQDYSDALGKNKSLH- 1047 Query: 394 LEYDEIKVNFDVMKTENEDLQRKTKLLEEVT 486 L++ E+K +++ EN + + L V+ Sbjct: 1048 LKFSELKGEICILEEENGAILEEAIALNNVS 1078 >At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-13) / HD-ZIP transcription factor 13 identical to homeobox gene 13 protein (GP:12325190) [Arabidopsis thaliana] Length = 294 Score = 32.7 bits (71), Expect = 0.15 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 235 NDLLEKH-KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANL 381 NDLL+ H +K+++E LK++ E ++ KET SCSN D NL Sbjct: 160 NDLLQTHNQKLQAEIMGLKNR--EQTESINLNKETEGSCSNRSDNSSDNL 207 Score = 31.1 bits (67), Expect = 0.47 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 370 KANLSVKTLE--YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 +A K LE YD +K FD +K EN+ LQ + L+ LK + Sbjct: 134 RARWKTKQLEKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNR 180 >At5g52280.1 68418.m06488 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 853 Score = 32.3 bits (70), Expect = 0.20 Identities = 16/72 (22%), Positives = 39/72 (54%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 E +K + S+ + + E DEY K+ ++ +IL+ L ++LEY E + + Sbjct: 467 ENYKNVSSKLEQQECSNAE--DEYLDSKDIIDELKSQIEILEGKLKQQSLEYSECLITVN 524 Query: 427 VMKTENEDLQRK 462 ++++ ++L+++ Sbjct: 525 ELESQVKELKKE 536 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/83 (21%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVK----TLEYDE 408 ++++ +K + EF EV+ +K +S +++++ NL + +L+Y E Sbjct: 681 IIQEWRKERDEFERKLSLAKEVAKTAQKELTLTKSSNDDKETRLRNLKTEVEGLSLQYSE 740 Query: 409 IKVNFDVMKTENEDLQRKTKLLE 477 ++ +F K EN++L+++ L+ Sbjct: 741 LQNSFVQEKMENDELRKQVSNLK 763 >At5g15150.1 68418.m01775 homeobox-leucine zipper protein 7 (HAT7) / HD-ZIP protein 7 / HD-ZIP protein (HB-3) identical to homeobox-leucine zipper protein HAT7 (HD-ZIP protein 7) (HD-ZIP protein ATHB-3) (SP:Q00466) [Arabidopsis thaliana] Length = 314 Score = 31.9 bits (69), Expect = 0.27 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 370 KANLSVKTLE--YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 +A K LE YD +K FDV+K++N+ L K L +LK+ Sbjct: 164 RARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELVALKK 209 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 31.9 bits (69), Expect = 0.27 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 6/82 (7%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIK-ETF--QSCSNERDILKANLSVKTLEYDEIKVNFD 426 KK+K + +KHL + +E + +K E F Q + E DI KAN V + + + V + Sbjct: 206 KKLKKAQKEEAEKHLRLQEELKALKRERFLWQLYNIENDIEKANEDVDSEKSNRKDVMRE 265 Query: 427 VMKTENEDLQRK---TKLLEEV 483 + K E E +RK K L+E+ Sbjct: 266 LEKFEREAGKRKVEQAKYLKEI 287 >At1g17140.2 68414.m02089 tropomyosin-related similar to Tropomyosin 1. [Baker's yeast](SP:P17536) {Saccharomyces cerevisiae} Length = 344 Score = 31.9 bits (69), Expect = 0.27 Identities = 18/87 (20%), Positives = 39/87 (44%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMK 435 K +K+ D++ +H + E E +K ++E +KAN + I + + Sbjct: 173 KMLKARLYDMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMVSKVSRIGEELEESR 232 Query: 436 TENEDLQRKTKLLEEVTFSLKQKSFEL 516 + L+ K + +EE +L+ + +L Sbjct: 233 AKTAHLKEKLESMEEAKDALEAEMKKL 259 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/95 (23%), Positives = 42/95 (44%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 ND EK + E LK + ++ E+E + + +S N+ + +S DE+ Sbjct: 159 NDEAEKLVAKEDEIKMLKARLYDMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMV 218 Query: 415 VNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 + E E+ + KT L+E S+++ L+ Sbjct: 219 SKVSRIGEELEESRAKTAHLKEKLESMEEAKDALE 253 >At1g17140.1 68414.m02088 tropomyosin-related similar to Tropomyosin 1. [Baker's yeast](SP:P17536) {Saccharomyces cerevisiae} Length = 344 Score = 31.9 bits (69), Expect = 0.27 Identities = 18/87 (20%), Positives = 39/87 (44%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMK 435 K +K+ D++ +H + E E +K ++E +KAN + I + + Sbjct: 173 KMLKARLYDMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMVSKVSRIGEELEESR 232 Query: 436 TENEDLQRKTKLLEEVTFSLKQKSFEL 516 + L+ K + +EE +L+ + +L Sbjct: 233 AKTAHLKEKLESMEEAKDALEAEMKKL 259 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/95 (23%), Positives = 42/95 (44%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIK 414 ND EK + E LK + ++ E+E + + +S N+ + +S DE+ Sbjct: 159 NDEAEKLVAKEDEIKMLKARLYDMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMV 218 Query: 415 VNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 + E E+ + KT L+E S+++ L+ Sbjct: 219 SKVSRIGEELEESRAKTAHLKEKLESMEEAKDALE 253 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 31.5 bits (68), Expect = 0.36 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 10/109 (9%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTD-----LKDKHLEVSDEYEKIKETFQSCSNERDIL-----K 372 K +L +KHKK+ E D LK + D +I + +S E D L + Sbjct: 545 KTEQENLKKKHKKIIDECKDRIRGVLKGRLPPEKDMKREIVQALRSIEREYDDLSLKSRE 604 Query: 373 ANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 A V L+ +VN + K N+D + + + +E +LKQ+S +D Sbjct: 605 AEKEVNMLQMKIQEVNNSLFK-HNKDTESRKRYIESKLQALKQESVTID 652 >At1g03830.1 68414.m00364 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 991 Score = 31.5 bits (68), Expect = 0.36 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 4/119 (3%) Frame = +1 Query: 175 VEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKD-KHLEVSDEYEKIKETFQSCS 351 V ++ V KI + K + E +++EF+ + D K ++++ K+ Q + Sbjct: 530 VSEQKAVTEKIAAMEEKLKQASTTEDG--LRAEFSRVLDEKEKIITEKAAKLATLEQQLA 587 Query: 352 NER-DILKANLSVK--TLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 + R ++ K+ L V + E ++++ ++ + E ++ ++LLE T +LK++ ELD Sbjct: 588 STRAELKKSALKVDECSSEAKDVRLQMSLLNEKYESVKSASELLETETETLKREKDELD 646 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 31.1 bits (67), Expect = 0.47 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 4/108 (3%) Frame = +1 Query: 190 TVAPKIPP---YDFKARFNDLLEKHK-KMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNE 357 T+ P PP ++ F + E ++ ++ DLKD+ S E +K+K+ + S Sbjct: 138 TITPPPPPPAPSNYAWDFINFFESYELPYTTDVNDLKDRETTPSHEEDKLKKKKITVSQN 197 Query: 358 RDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 + +K KTL E N E++D Q+ + L EVT L++ Sbjct: 198 DEKIKVEEEKKTLRISE--KNRKRAPKESKD-QKVSSDLSEVTKQLQE 242 >At2g42480.1 68415.m05255 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 743 Score = 30.7 bits (66), Expect = 0.62 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +1 Query: 223 KARFNDLLEKHKKMK-SEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLE 399 ++R L E+ KK++ E DLK K EVS E +K + ++S + + NL + L+ Sbjct: 660 RSRIQRLEERVKKLELMELDDLKSKLEEVSLERKKSDDAYRSRVYQLEECFKNLELMVLD 719 Query: 400 YDEIKVNFDVMKTENED 450 + KV D K ++ D Sbjct: 720 F---KVELDKKKDKSCD 733 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 30.3 bits (65), Expect = 0.82 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +1 Query: 256 KKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANL-SVKTLEYDEIKVNFDVM 432 ++ + E+ +LKD E+ + EK++ ERD ++ + +K LE +KV D M Sbjct: 721 ERREREWAELKDSVEELKVQREKLETQRHMLRAERDEIRHEIEELKKLE--NLKVALDDM 778 Query: 433 KTENEDLQRKTKLLEEVTFSLKQKSFELD 519 L + E+V+ +LKQK D Sbjct: 779 SMAKMQLSNLERSWEKVS-ALKQKVVSRD 806 >At5g45380.1 68418.m05577 sodium:solute symporter family protein contains Pfam profile: PF00474 sodium:solute symporter family Length = 694 Score = 30.3 bits (65), Expect = 0.82 Identities = 23/73 (31%), Positives = 36/73 (49%) Frame = -1 Query: 224 LKS*GGIFGATVDLFSTFVTLFGIVVDDGAVADLLIRGAAAETGGPFRKGLV*LVIKFFL 45 L S G +FG +++ F T+F VD+G + ++ G GLV + F L Sbjct: 290 LSSGGAVFGL-INIVGNFGTVF---VDNGYWVSAIAARPSSTHKGYLLGGLVWFAVPFSL 345 Query: 44 STSLRPLAIVLDM 6 +TSL A+ LD+ Sbjct: 346 ATSLGLGALALDL 358 >At4g31570.1 68417.m04483 expressed protein Length = 2712 Score = 30.3 bits (65), Expect = 0.82 Identities = 21/72 (29%), Positives = 34/72 (47%) Frame = +1 Query: 265 KSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTEN 444 +S TDL+ +V D ++ QSC +ER L L +++ + ++ EN Sbjct: 1610 QSVTTDLEVSQKQVGD----VEGNLQSCVSERVNLSERLESLIGDHESLSARGIHLEVEN 1665 Query: 445 EDLQRKTKLLEE 480 E LQ + K L E Sbjct: 1666 EKLQNQVKDLHE 1677 >At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 634 Score = 30.3 bits (65), Expect = 0.82 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +1 Query: 289 DKHLEVSDEYEKIKE-TFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKT 465 D+ L + DE+++ KE T L + ++ +E E+K VMK E+ED + Sbjct: 381 DRVLRLVDEHKRKKEETLNKILQLEKELDSKQKLQ-MEIQELKGKLKVMKHEDEDDEGIK 439 Query: 466 KLLEEVTFSLKQKSFEL 516 K ++++ L++K EL Sbjct: 440 KKMKKMKEELEEKCSEL 456 >At1g11690.1 68414.m01342 hypothetical protein Length = 247 Score = 30.3 bits (65), Expect = 0.82 Identities = 25/100 (25%), Positives = 47/100 (47%) Frame = +1 Query: 178 EKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNE 357 EK T P + Y K + + E+ K++K+E + LK K L++ +++ E Sbjct: 73 EKEETTNPFVD-Y-LKEKLSKEREEKKRVKAENSRLKKKILDMESSVNRLRR-------E 123 Query: 358 RDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLE 477 RD ++ DE+KVN + E E+ ++ ++ E Sbjct: 124 RDTMEKVCEELVTRIDELKVNTRRVWDETEEERQMLQMAE 163 >At1g26960.1 68414.m03287 homeobox-leucine zipper protein, putative / HD-ZIP transcription factor, putative similar to homeobox-leucine zipper protein HAT7 (HD-ZIP protein 7) (HD-ZIP protein ATHB-3 (SP:Q00466| [Arabidopsis thaliana]; similar to Helianthus annuus gi|349379, and carrot, gi|1435022. Contains Homeobox domain motif Length = 255 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 370 KANLSVKTLE--YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 +A K LE YD +K F+ ++ ENE LQ + + L+ +LK + Sbjct: 120 RARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSR 166 >At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II) (SP:Q99323) {Drosophila melanogaster} similar to EST gb|T76116 Length = 1730 Score = 29.9 bits (64), Expect = 1.1 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 3/98 (3%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILK---ANLSVKTLEYD 405 + L EK ++ + T+L++K + + + QS + + D L+ A L+ +++ + Sbjct: 344 HQLSEKTTELANRLTELQEKEIALESSEVMKGQLEQSLTEKTDELEKCYAELNDRSVSLE 403 Query: 406 EIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 ++ K + L KTK LEE L++ S LD Sbjct: 404 AYELT---KKELEQSLAEKTKELEECLTKLQEMSTALD 438 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 61 TNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPP 213 +N +++ PP A PR+ + +P T P + R+ AP PP Sbjct: 744 SNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 28.3 bits (60), Expect = 3.3 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 52 NLITNHTRPLRNGPPVSAA--APRIKRSATAPSSTTIPNN-VTKVEKRSTVAPKIPP 213 N+ +N +P R+ PP+S + P + R P + ++ VTKV AP PP Sbjct: 662 NVASNLGQPARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 >At3g44050.1 68416.m04718 kinesin motor protein-related KLP2 protein, Xenopus laevis, PIR:T30335 Length = 1229 Score = 29.5 bits (63), Expect = 1.4 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 E+ KKM +L+++ E+ DE EK+ +++ E+D LK LS + I+ N D Sbjct: 806 EEQKKM---IGNLENQLTEMHDENEKLMSLYENAMKEKDELKRLLSSPD-QKKPIEANSD 861 Query: 427 V-MKTENEDLQRKTKLLEEVTFSLK 498 M+ N ++ T+ L L+ Sbjct: 862 TEMELCNISSEKSTEDLNSAKLKLE 886 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/68 (22%), Positives = 39/68 (57%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 DF+++ N ++ + ++++ +L+DK + + + E+++E + E I+ + + T Sbjct: 1050 DFQSKENVTEKQVEILETQMEELQDKLRDTTMDNEQLQEQLRGKDMELLIISNEMELLTS 1109 Query: 397 EYDEIKVN 420 E +EI +N Sbjct: 1110 ELEEILLN 1117 >At2g14045.2 68415.m01562 expressed protein Length = 122 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS 345 D + ++N+LL KH++ E +K H S + + +ET ++ Sbjct: 70 DLQIKYNELLAKHQETLRELNGVKSLHSRNSSKDDADRETLEA 112 >At2g14045.1 68415.m01561 expressed protein Length = 122 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS 345 D + ++N+LL KH++ E +K H S + + +ET ++ Sbjct: 70 DLQIKYNELLAKHQETLRELNGVKSLHSRNSSKDDADRETLEA 112 >At1g76740.1 68414.m08931 expressed protein weak similarity to fimbriae-associated protein Fap1 (GI:3929312) [Streptococcus parasanguinis]; weak similarity to 1MDa_1 protein (GI:24620455) [Caenorhabditis elegans] Length = 1532 Score = 29.5 bits (63), Expect = 1.4 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 4/90 (4%) Frame = +1 Query: 235 NDLLEKHKKMKSE---FTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYD 405 ND E++ K K E FT + + +S E I E C NE + K + ++ + Sbjct: 639 NDFAEENSKTKEEGLIFTPVSELKEPIS--VEAILENSVECWNEIHLSKHDEKGTNIQAE 696 Query: 406 EIKVNFDVMKTENEDLQ-RKTKLLEEVTFS 492 + NF TEN + ++L+E++ S Sbjct: 697 NLHGNFSECNTENSKVVIVHPEMLDEISVS 726 >At1g54450.1 68414.m06211 calcium-binding EF-hand family protein contains Pfam profile: PF00036 EF hand Length = 535 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +1 Query: 76 PLRNGPPV----SAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDL 243 P RNGPP+ S +PRI R T S+ + P V + + P+ D + NDL Sbjct: 82 PARNGPPLSPRNSTGSPRIARQRTGLSNLSSPLKVVSDHVKELI-PQFYFEDGRPPPNDL 140 Query: 244 LEK 252 E+ Sbjct: 141 KEQ 143 >At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:433663 from (Arabidopsis thaliana) Length = 1520 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +1 Query: 331 ETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRK 462 E S SNE D LK LS +T + DE + + +NE+L +K Sbjct: 969 EKIDSLSNEIDRLKGLLSSETHKADEAQHAYQSALVQNEELCKK 1012 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 29.5 bits (63), Expect = 1.4 Identities = 24/99 (24%), Positives = 52/99 (52%), Gaps = 4/99 (4%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKI-KETFQSCSNERDILKANLSVK-TLEYDE 408 NDL +++++K + L++K E +YE+I K + + +E ++ + +K E + Sbjct: 997 NDLAAENEQLKESVSSLQNKIDESERKYEEISKISEERIKDEVPVIDQSAIIKLETENQK 1056 Query: 409 IKVNFDVMKTENEDLQRK-TKLLEEVTFSLKQK-SFELD 519 +K M+ + ++L RK + +T LK+ SF+ + Sbjct: 1057 LKALVSSMEEKIDELDRKHDETSPNITEKLKEDVSFDYE 1095 >At5g02210.1 68418.m00142 expressed protein ; expression supported by MPSS Length = 161 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/78 (24%), Positives = 39/78 (50%) Frame = +1 Query: 193 VAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILK 372 ++ +I ++++++N+ + +K+ +D +++H D + K Q SNE +K Sbjct: 4 ISSRILKPEYRSQYNNQIPMQEKVVDSSSDWQNQH----DVFMKGGGCKQQRSNEESHVK 59 Query: 373 ANLSVKTLEYDEIKVNFD 426 LS T+ DEI D Sbjct: 60 TFLSSTTVSLDEINEEED 77 >At3g59200.1 68416.m06600 F-box family protein contains F-box domain Pfam:PF00646 Length = 520 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/78 (26%), Positives = 31/78 (39%) Frame = +1 Query: 163 NVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 342 N+ +E +A K P K FN L+E H ++ D D + + E Q Sbjct: 236 NLVYLEYSDAIASKYP----KVNFNSLVEAHIGLRLTEDQSGDADFSEEDYFSEGDEKKQ 291 Query: 343 SCSNERDILKANLSVKTL 396 N D LK +V+ L Sbjct: 292 MVGNATDFLKGISTVQIL 309 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 29.1 bits (62), Expect = 1.9 Identities = 24/113 (21%), Positives = 46/113 (40%) Frame = +1 Query: 181 KRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNER 360 KR K+ F+A DL + + + EF + + D E+ + + E Sbjct: 583 KRELDGVKMQKESFEADMEDLEMQKRNLDMEFQ--RQEEAGERDFNERARTYEKRSQEEL 640 Query: 361 DILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 D + + E +E++ ++ E E + + KLL+E + + ELD Sbjct: 641 DNINYTKKLAQREMEEMQYEKLALEREREQISVRKKLLKEQEAEMHKDITELD 693 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 28.7 bits (61), Expect = 2.5 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 5/98 (5%) Frame = +1 Query: 235 NDLLEKHKKMKS-EFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEI 411 N +LEK + E L+DK D ++ +K ER+ L + L + + Sbjct: 646 NSVLEKSLSCANIELESLRDKSKCFDDFFQFLKNDKSELMKERESLVSQLCKVEEKLGVL 705 Query: 412 KVNFDVMKTENEDLQRKTKL----LEEVTFSLKQKSFE 513 + + ++ DLQR KL +EE+ SL + E Sbjct: 706 EKKYTELEVRYTDLQRDNKLKSHQVEELQVSLAAEKQE 743 >At3g52115.1 68416.m05720 hypothetical protein Length = 588 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +1 Query: 310 DEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTF 489 D I +S + + L+ LS KTL + + + + TE D +RK +EE Sbjct: 157 DGINMIVSEVKSLKMKTEFLQEELSKKTLVTENLLKKLEYLSTEAADGERKLSSVEEEKQ 216 Query: 490 SLKQK 504 LK + Sbjct: 217 RLKTR 221 >At3g48860.2 68416.m05337 expressed protein Length = 577 Score = 28.7 bits (61), Expect = 2.5 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 9/136 (6%) Frame = +1 Query: 100 SAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFND---------LLEK 252 SA+A R SA + + T IPN + IPP D R D + K Sbjct: 147 SASAGRPSMSARSTTPTPIPNLMPPSRVSVKTPVSIPPLDPPTRSRDKRFFADVPSVNSK 206 Query: 253 HKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVM 432 K + E + L+D+ + +E E + E + +R ++A K LE + + + Sbjct: 207 EKGDQREASALRDELDMLQEENENVLEKLRRAEEKR--VEAEARAKELEKQVASLG-EGV 263 Query: 433 KTENEDLQRKTKLLEE 480 E + L RK L + Sbjct: 264 SLEAKLLSRKEAALRQ 279 >At3g48860.1 68416.m05336 expressed protein Length = 494 Score = 28.7 bits (61), Expect = 2.5 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 9/136 (6%) Frame = +1 Query: 100 SAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFND---------LLEK 252 SA+A R SA + + T IPN + IPP D R D + K Sbjct: 147 SASAGRPSMSARSTTPTPIPNLMPPSRVSVKTPVSIPPLDPPTRSRDKRFFADVPSVNSK 206 Query: 253 HKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVM 432 K + E + L+D+ + +E E + E + +R ++A K LE + + + Sbjct: 207 EKGDQREASALRDELDMLQEENENVLEKLRRAEEKR--VEAEARAKELEKQVASLG-EGV 263 Query: 433 KTENEDLQRKTKLLEE 480 E + L RK L + Sbjct: 264 SLEAKLLSRKEAALRQ 279 >At3g12930.1 68416.m01611 expressed protein contains Pfam domain PF02410: Domain of unknown function DUF143 Length = 238 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSV 387 D F+DL K+ K+ TD+K EV D+ E + + D+ ++ V Sbjct: 85 DTDEMFDDLFNKYGKVVFRSTDVKSPTAEVDDDAESLAFAVELAKVASDVKAGDIKV 141 >At2g15620.1 68415.m01789 ferredoxin--nitrite reductase, putative strong similarity to ferredoxin--nitrite reductase [Nicotiana tabacum] GI:19893; contains Pfam profiles PF03460: Nitrite/Sulfite reductase ferredoxin-like half domain, PF01077: Nitrite and sulphite reductase 4Fe-4S domain Length = 586 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/68 (32%), Positives = 29/68 (42%) Frame = +1 Query: 127 SATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEV 306 S PSS+T P V T AP A D LE ++K F LK+K + Sbjct: 10 SPLLPSSSTKPKRSVLVAAAQTTAPAESTASVDA---DRLEPRVELKDGFFILKEKFRKG 66 Query: 307 SDEYEKIK 330 + EK+K Sbjct: 67 INPQEKVK 74 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 28.3 bits (60), Expect = 3.3 Identities = 27/109 (24%), Positives = 53/109 (48%) Frame = +1 Query: 175 VEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSN 354 +E + +PP++ K F D +E H FT K+ ++ D Y ++K + Sbjct: 213 LEVKKVNLESLPPWEEKKMFKDFMEDHN--TGTFT--SKKYYDI-DGYYRLKLEKEM--- 264 Query: 355 ERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQ 501 ++ + KA +S +T+ DE + + E ++L+ + K EE +LK+ Sbjct: 265 KKGLKKAGISERTVFNDE-----EQRRLEMQELRERQK--EEEVLALKR 306 >At5g27330.1 68418.m03263 expressed protein Length = 628 Score = 28.3 bits (60), Expect = 3.3 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 14/95 (14%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKA---------NL---S 384 L ++ ++E DLK + + + E +E F +ERD++K+ NL S Sbjct: 135 LFKEKSDRETEIRDLKREANGLIRKLESEREEFSRVCDERDLVKSGFDLQSEEMNLLKES 194 Query: 385 VKTLEYDEIKVNFDV--MKTENEDLQRKTKLLEEV 483 V LE E+ + +V +K EN L ++ K EEV Sbjct: 195 VVRLEMREVSLGEEVGRLKCENGRLVKERKKREEV 229 >At5g13950.1 68418.m01631 expressed protein Length = 939 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/34 (32%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 274 FTDLKDKHLEVSDEYEKIKETFQSCSN-ERDILK 372 +++L+ H ++ D + +KE ++SC + E+DI+K Sbjct: 181 YSNLEKYHQDIIDYLQTLKEKWESCKDPEKDIVK 214 >At5g07890.1 68418.m00910 myosin heavy chain-related contains weak similarity to Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha) (Alpha isomyosin) (Fragment) (Swiss-Prot:P04460) [Oryctolagus cuniculus] Length = 409 Score = 28.3 bits (60), Expect = 3.3 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 13/98 (13%) Frame = +1 Query: 217 DFK-ARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT 393 +FK A +L E+ ++ E K +HL + E E + Q S + L+ +S T Sbjct: 119 EFKLAESRNLEEEVNSLRDELCMSKSEHLLLLQELESKEIELQCSSLTLEKLEETISSLT 178 Query: 394 L----EYDEIKVN--------FDVMKTENEDLQRKTKL 471 L E + +K++ FD MK + E +Q K +L Sbjct: 179 LESLCEIESMKLDITALEQALFDAMKIQEESIQEKDQL 216 >At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related protein, putative similar to kinesin like protein GB:CAB10194 from [Arabidopsis thaliana] Length = 1313 Score = 28.3 bits (60), Expect = 3.3 Identities = 8/30 (26%), Positives = 21/30 (70%) Frame = +1 Query: 244 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKE 333 ++ H +M ++ DL++KH+++ + +I+E Sbjct: 1101 MQGHARMIEQYADLEEKHIQLLARHRRIRE 1130 >At3g22860.1 68416.m02882 eukaryotic translation initiation factor 3 subunit 8, putative / eIF3c, putative similar to eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) [Arabidopsis thaliana] SWISS-PROT:O49160 Length = 800 Score = 28.3 bits (60), Expect = 3.3 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Frame = +1 Query: 247 EKHKKMKSEFTDLKD-KHLEVSDEYEKIKETFQSCSNE--RDILKANLSVKTLEYDEIKV 417 +K K+ + +++ KH ++ ++ETF+ + + + + L +KTL E + Sbjct: 50 KKDKRFEEMANTIENMKHAMNINDCVYLQETFEKLNKQISKSVKTPTLYIKTLVMLEDFL 109 Query: 418 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFE 513 N D MKT+ + +K L + LK+ + + Sbjct: 110 NEDNMKTKEKMSTSNSKALNAMRQKLKKNNLQ 141 >At3g13222.1 68416.m01655 expressed protein Length = 567 Score = 28.3 bits (60), Expect = 3.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 22 ANGLSDVDKKNLITNHTRPLRNGPPVSAAAPRIKRSATAPSSTTIPNNVT 171 +NG S KK NH + G +++AP R+ T PSS PN ++ Sbjct: 99 SNGRSAAFKKQSGANH---IIGGSGTASSAPNNARNDTKPSSIMAPNPIS 145 >At2g37080.1 68415.m04550 myosin heavy chain-related low similarity to myosin heavy chain [Rana catesbeiana] GI:4249701 Length = 583 Score = 28.3 bits (60), Expect = 3.3 Identities = 18/77 (23%), Positives = 35/77 (45%) Frame = +1 Query: 103 AAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTD 282 A+ P+ R S + + TK+ T +PK+ D ++ + E KK + + Sbjct: 20 ASTPKTARKLKTSESDPVSSPNTKIRTPKTQSPKVVA-DRRSPRTPVNEIQKKRTGKTPE 78 Query: 283 LKDKHLEVSDEYEKIKE 333 L + ++ +E +K KE Sbjct: 79 LASQISQLQEELKKAKE 95 >At1g65280.1 68414.m07402 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 598 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = +1 Query: 145 STTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEK 324 ++ + +N + KRS A + Y+ + R L+EKH++ S + K ++S EK Sbjct: 486 ASALASNEGENMKRSMDAELVDKYNKEKRAKSLVEKHREDSSSSSSRLKKKKKLSSSKEK 545 Query: 325 IKE 333 ++ Sbjct: 546 TEK 548 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 28.3 bits (60), Expect = 3.3 Identities = 19/103 (18%), Positives = 49/103 (47%), Gaps = 4/103 (3%) Frame = +1 Query: 217 DFKARFNDLLEK----HKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLS 384 +++A+ ++L EK +M+ +L +K E+ ++ ++ + + E ILK + Sbjct: 679 EYEAKLHELSEKLSFKTSQMERMLENLDEKSNEIDNQKRHEEDVTANLNQEIKILKEEIE 738 Query: 385 VKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFE 513 D + + + + DL++ K + E SL++++ + Sbjct: 739 NLKKNQDSLMLQAEQAENLRVDLEKTKKSVMEAEASLQRENMK 781 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 27.9 bits (59), Expect = 4.4 Identities = 20/79 (25%), Positives = 40/79 (50%) Frame = +1 Query: 163 NVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 342 ++ ++K S YD R N++L +E +D +DK ++V+DE E ++ + Sbjct: 490 HIKNLKKTSNHQYSDDSYDVGPRSNNVLFPSS---NESSDCEDKVMDVTDELEFQEKEIE 546 Query: 343 SCSNERDILKANLSVKTLE 399 CS + K ++ +K L+ Sbjct: 547 HCSLQE---KLDMELKELD 562 >At5g56160.1 68418.m07006 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus] and SEC14 cytosolic factor (SP:P45816) [Candida lipolytica] Length = 592 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/50 (24%), Positives = 29/50 (58%) Frame = +1 Query: 178 EKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKI 327 ++++TV +P + + ++ KKM+ EFT++ K +++ + EK+ Sbjct: 496 QRQNTVV--VPDSSTNNKVLECFDRLKKMEKEFTEISRKQVKIPEANEKL 543 >At5g41140.1 68418.m05001 expressed protein Length = 983 Score = 27.9 bits (59), Expect = 4.4 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 8/69 (11%) Frame = +1 Query: 160 NNVTKVEKRSTVAP--------KIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDE 315 +N+TK E+RS K+ +A +EK K +K+ +L+ K EVS Sbjct: 836 DNITKTEQRSNEDRIKQLEGQIKLKENALEASSKIFIEKEKDLKNRIEELQTKLNEVSQN 895 Query: 316 YEKIKETFQ 342 ++ ET Q Sbjct: 896 SQETDETLQ 904 >At5g16620.1 68418.m01946 hydroxyproline-rich glycoprotein family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 447 Score = 27.9 bits (59), Expect = 4.4 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKVEKRSTVAPK-IPPYDFKA-RFNDLLEKHKKM 264 PP ++ A +S + S T+ TKVE + PK P D + + + +LE K+ Sbjct: 168 PPQTSPASSPFQSQSQSSGATVDVTATKVETPPSTKPKPTPAKDIEVDKPSVVLEASKEK 227 Query: 265 KSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 K E K+ E E KE+ SN ++ + N +T ++++ N Sbjct: 228 KEE----KNYAFEDISPEETTKES--PFSNYAEVSETNSPKETRLFEDVLQN 273 >At5g07660.1 68418.m00877 structural maintenance of chromosomes (SMC) family protein similar to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1058 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +1 Query: 229 RFNDLLEKHKKMKSE-FTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYD 405 + N L++ + SE DL+ H E + K ++T++SC R+ LK ++ Sbjct: 858 KINHRLKRENENYSESIDDLRIMHGEKEQKIGKKRKTYKSC---REKLKVCKDAVDSRWN 914 Query: 406 EIKVNFDVMKTE 441 +++ N D++K E Sbjct: 915 KLQRNKDLLKRE 926 >At4g29440.1 68417.m04203 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 1090 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 127 SATAPSSTTIPNNVTKV-EKRSTVAPKIPPYD 219 S++ P + T P+ T EK S V PK+P YD Sbjct: 1048 SSSLPKTVTSPDPETPAKEKASHVHPKLPDYD 1079 >At4g15030.1 68417.m02309 expressed protein Length = 179 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +1 Query: 307 SDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQ 456 +DE EK KE +S SNE+ K N S EYD + + KT L+ Sbjct: 106 TDEEEKRKEGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKSKLE 155 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 27.9 bits (59), Expect = 4.4 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 5/99 (5%) Frame = +1 Query: 235 NDLLEKHKKMKSEFTD--LKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 408 N L + KK++ E + + K LEV+ KIKE + + + K L + Sbjct: 187 NSLQAERKKLQEELSQNGIVRKELEVARN--KIKELQRQIQLDANQTKGQLLLLKQHVSS 244 Query: 409 IKVNFDVMKTENEDLQRKTKLLEEV---TFSLKQKSFEL 516 +++ + ++ +++RK K ++++ LK+K+ EL Sbjct: 245 LQMKEEEAMNKDTEVERKLKAVQDLEVQVMELKRKNREL 283 >At1g66180.1 68414.m07512 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 430 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 139 PSSTTIPNN--VTKVEKRSTVAPKIPPYDFKARF 234 P STT ++ T + R +P PPY+F++RF Sbjct: 33 PISTTTNSHRFTTSLLSRKNPSPSSPPYNFRSRF 66 >At1g21695.1 68414.m02716 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 91 PPVSAAAPRIKRSATAPSSTTIPNNVTKV--EKRS-TVAPKIPPYDFKAR 231 PP P +K +T PS++ P++ + E RS V+P PP FK + Sbjct: 39 PPPPNKLPPLKLKSTPPSNSPSPSSSSSFFSESRSRPVSPFAPPPSFKLK 88 >At1g09720.1 68414.m01091 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 928 Score = 27.9 bits (59), Expect = 4.4 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 8/70 (11%) Frame = +1 Query: 244 LEKHKK-MKSEFTDLKDKHLEVSDEYEKIKETFQSCSNE-----RDILKANLSVKTL--E 399 +EK K + S+ D+K + + DE K+K FQ ++ + + +AN + K L + Sbjct: 379 VEKDKACLVSDSMDMKKRITVLEDELRKVKNLFQRVEDQNKNLHKHLTEANSTAKDLSGK 438 Query: 400 YDEIKVNFDV 429 E+K++ DV Sbjct: 439 LQEVKMDEDV 448 >At5g65310.1 68418.m08216 homeobox-leucine zipper protein 5 (HB-5) / HD-ZIP transcription factor 5 identical to homeobox-leucine zipper protein ATHB-5 (HD-ZIP protein ATHB-5) (SP:P46667) [Arabidopsis thaliana] Length = 312 Score = 27.5 bits (58), Expect = 5.8 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 11/97 (11%) Frame = +1 Query: 247 EKHKKMKSEFTDLKDKHLEVSDEYE---KIKETFQSCSNERDIL------KANLSVKTLE 399 EK +++ E +K+ E+ ++ E K+K + R + +A K LE Sbjct: 71 EKKRRLGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLE 130 Query: 400 --YDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQK 504 Y +K NFD +K + LQR L LK K Sbjct: 131 RDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAK 167 >At5g60580.3 68418.m07597 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 487 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 112 PRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIP 210 PRIKR+++ P + I +N ++VAP+ P Sbjct: 154 PRIKRTSSLPVTPVILSNSESAHGGTSVAPQTP 186 >At5g60580.2 68418.m07596 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 494 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 112 PRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIP 210 PRIKR+++ P + I +N ++VAP+ P Sbjct: 154 PRIKRTSSLPVTPVILSNSESAHGGTSVAPQTP 186 >At5g60580.1 68418.m07595 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 487 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 112 PRIKRSATAPSSTTIPNNVTKVEKRSTVAPKIP 210 PRIKR+++ P + I +N ++VAP+ P Sbjct: 154 PRIKRTSSLPVTPVILSNSESAHGGTSVAPQTP 186 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 27.5 bits (58), Expect = 5.8 Identities = 19/90 (21%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 D + ++ E +KK + + KD +YE +K++ R + + Sbjct: 906 DITQKAFEIQETYKKTQQLIDEHKDVLTGAKSDYENLKKSVDELKASRVDAEFKVQDMKK 965 Query: 397 EYDEIKVNFDVMKTENEDLQ-RKTKLLEEV 483 +Y+E+++ K + DLQ TK +E++ Sbjct: 966 KYNELEMREKGYKKKLNDLQIAFTKHMEQI 995 >At5g45310.1 68418.m05562 expressed protein Length = 352 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/100 (18%), Positives = 46/100 (46%) Frame = +1 Query: 184 RSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERD 363 R ++ + + F RF + + + ++ DL+ + + ++I++ + E Sbjct: 63 RGSIWGSVLLFTFPIRFFASIPRERLLEQSIYDLRYELESLEWNRKEIEKNLREAIKEYR 122 Query: 364 ILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEV 483 I++ +L E+DE + ++ E ++L+ + L EV Sbjct: 123 IMEQDLDELEDEHDEAISKIEKLEAELQELKEENLQLMEV 162 >At5g41780.1 68418.m05087 myosin heavy chain-related weak similarity to M protein, serotype 5 precursor (SP:P02977) {Streptococcus pyogenes} and to Myosin heavy chain, non-muscle (SP:Q99323) (Zipper protein) (Myosin II) {Drosophila melanogaster} Length = 537 Score = 27.5 bits (58), Expect = 5.8 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 5/111 (4%) Frame = +1 Query: 199 PKIPPYDFKARFNDLLEKHKKMKSEF----TDLKDKHLEVSDEYEKIKETFQSCSNERDI 366 PK+ + DL ++ + + S F TD + L + + S E +I Sbjct: 26 PKVTKKELVGIVEDLHKQCQLLYSVFDDFGTDGRKGKLGTASSSRSSSDLDYYSSEEVEI 85 Query: 367 LKANLS-VKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 N+S + +YD + + NEDL+R+ L++ T L+ ++ E+ Sbjct: 86 SADNVSDTLSSDYDVMLRKLQETELRNEDLERQVSNLKQETVFLRDQNMEV 136 >At5g18940.1 68418.m02249 Mo25 family protein similar to SP|Q06138 MO25 protein {Mus musculus}; contains Pfam profile PF03204: Mo25 protein family Length = 345 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKI 327 D + F DLL KH + SEF L + E D YE++ Sbjct: 186 DAFSTFKDLLTKHDSVVSEF--LTSHYTEFFDVYERL 220 >At5g15040.1 68418.m01763 paired amphipathic helix repeat-containing protein contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 87 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 342 + K F+D +EK+ K+ DLK + + + ++KE F+ Sbjct: 10 EVKDTFHDQIEKYDMFKNILLDLKARRIGRHTAFAQLKELFK 51 >At2g46240.1 68415.m05750 IQ domain-containing protein / BAG domain-containing protein contains Pfam profiles PF00612: IQ calmodulin-binding motif, PF02179: BAG (Apoptosis regulator Bcl-2 protein) domain Length = 1043 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 127 SATAPSSTTIPNNVTKVEKRSTVAPKIPP 213 +A A SSTTIP + +VE TV P PP Sbjct: 767 NAAAASSTTIPEKIGEVE---TVVPGNPP 792 >At2g22430.1 68415.m02660 homeobox-leucine zipper protein 6 (HB-6) / HD-ZIP transcription factor 6 identical to homeobox-leucine zipper protein ATHB-6 (HD-ZIP protein ATHB-6) (SP:P46668) [Arabidopsis thaliana] Length = 311 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 367 LKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLE 477 L+ + V +YD ++ NFD ++ +NE L ++ L+ Sbjct: 119 LEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLK 155 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 27.5 bits (58), Expect = 5.8 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 2/98 (2%) Frame = +1 Query: 217 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 396 + + F D E++++ E D V + +EK++E + ERD+ K + Sbjct: 338 ELRESFTDYEEENEE--EEIDGPLDSPESVEELHEKLQEELNIDNEERDVKKEVVGEADE 395 Query: 397 EYDEIKVNFDVMK--TENEDLQRKTKLLEEVTFSLKQK 504 DE V + M+ +E+ED + LL+++ K K Sbjct: 396 TDDEYFVAEEDMQGSSESEDEDDEMTLLKKMVSGQKNK 433 >At1g69060.1 68414.m07902 expressed protein Length = 630 Score = 27.5 bits (58), Expect = 5.8 Identities = 25/121 (20%), Positives = 58/121 (47%), Gaps = 1/121 (0%) Frame = +1 Query: 139 PSSTTIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEV-SDE 315 P IP+ +V+ + AP I + + +++K+ + E + + + L++ +DE Sbjct: 439 PIIDPIPSTSGQVQGTNGTAPAIDVMLNREILKET-DEYKRAQEEEWESRQRQLQIQADE 497 Query: 316 YEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSL 495 +K ++ + N R L ++ + + ++ + K + E++ K K+ E+T SL Sbjct: 498 AQKQRKR-RKLENMR-----KLEMERRQKERVEEVRETQKKDEENMNMKEKVRAEITKSL 551 Query: 496 K 498 K Sbjct: 552 K 552 >At1g59540.1 68414.m06694 kinesin motor protein-related similar to kinesin motor protein (kin2) GI:2062751 from (Ustilago maydis) Length = 823 Score = 27.5 bits (58), Expect = 5.8 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 20/107 (18%) Frame = +1 Query: 250 KHKKMKSEFTDLKDKHLEVSDE--------------YEKIKETFQSCSNERDILKANLSV 387 + KK+KSE +K+++ E+ E +EK+ + Q ERD L +S Sbjct: 695 EEKKLKSELIIIKERYNELEKELCLDKQLLEASRESHEKLIKEVQFLKEERDSLDRKISQ 754 Query: 388 KTLEYDEIKVNFD-VMKTENEDLQRKTKLLEE-----VTFSLKQKSF 510 T I + + +K N +++R+ + EE + F+ + KSF Sbjct: 755 STQRLRVIASDKENALKDLNVEVKRRKDMEEEIKHISIAFATRHKSF 801 >At1g21810.1 68414.m02729 expressed protein Length = 628 Score = 27.5 bits (58), Expect = 5.8 Identities = 19/95 (20%), Positives = 44/95 (46%) Frame = +1 Query: 232 FNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEI 411 F ++ K +K+++E +L + + + ++ ++ ++ ++ L E E+ Sbjct: 346 FQEVDTKLEKLQAEKDELDSEVICCKEAEKRFSLELEAVVGDKIEMEDELEKMEAEKAEL 405 Query: 412 KVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFEL 516 K++FDV+K + Q +EV L+ EL Sbjct: 406 KISFDVIK---DQYQESRVCFQEVEMKLEAMKREL 437 >At5g55490.1 68418.m06911 expressed protein Length = 537 Score = 27.1 bits (57), Expect = 7.7 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 4/83 (4%) Frame = +1 Query: 259 KMKSEFTDLKDKHLE----VSDEYEKIKETFQSCSNERDILKANLSVKTLEYDEIKVNFD 426 KMK D D L+ + + +K+K + E +L NLS K ++ D Sbjct: 202 KMKETLKDGMDMFLDAYTNIQEGVDKLKSDTEQIEVEISVLGNNLSTKMIDLQ--STTDD 259 Query: 427 VMKTENEDLQRKTKLLEEVTFSL 495 + L ++ KLL+ T +L Sbjct: 260 IGTKTRSSLDKQQKLLDGQTVAL 282 >At3g58410.1 68416.m06510 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 328 Score = 27.1 bits (57), Expect = 7.7 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 14/107 (13%) Frame = +1 Query: 241 LLEKHKKMKSEFTDLKDKHLEVS------DEYEKIKETFQSCSNERDILKANLSVKTLEY 402 + E+H + SEF K+++L + E + ++ Q SNE D+++A++++ L+ Sbjct: 201 IFERHPDIASEFR-AKNQYLRKACMDFLLSLVETLCQSLQEFSNE-DLVEADIALTYLKD 258 Query: 403 DEIKVNF-----DVMKTENEDLQR---KTKLLEEVTFSLKQKSFELD 519 KV++ D ++ + E + K + EE LKQK ELD Sbjct: 259 AGFKVDWLEKKLDQVRDKKEKERSCLAKLQETEETLLKLKQKCTELD 305 >At3g54870.1 68416.m06079 armadillo/beta-catenin repeat family protein / kinesin motor family protein kinesin, Syncephalastrum racemosum, AJ225894 Length = 941 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 10/69 (14%) Frame = +1 Query: 223 KARFNDLLEKHKKMKSEFTDLKDKHL-------EVSDEYEKIKETFQSCSN---ERDILK 372 K ++DLL++ +K+ E D+K++ L ++ E K+K+ + N E+ +K Sbjct: 703 KLDYDDLLQQKEKLGEEVRDMKERLLLEEKQRKQMESELSKLKKNLRESENVVEEKRYMK 762 Query: 373 ANLSVKTLE 399 +LS + E Sbjct: 763 EDLSKGSAE 771 >At2g24650.1 68415.m02944 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 1440 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 340 QSCSNERDILKANLSVKTLEYDEIKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELD 519 +SCS + AN++ TL YD + + M+ D +R E + + K KS+ LD Sbjct: 1178 ESCSLDPSCFVANVAPSTLRYDTLYLPKRFMRENGVDKRRG----EMILMNEKGKSWTLD 1233 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 27.1 bits (57), Expect = 7.7 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = +1 Query: 250 KHKKMKSEFTDLKD--KHLEVSDE-YEKIKETFQSCSNERDILKANLSVKTLEYDEIKVN 420 K + +K + L+D + L V + Y+K++E + L+ ++ + E V+ Sbjct: 700 KERPLKGDIILLEDMKRSLHVQESLYQKVEEELYEMHSRNLYLEVFSNILRETFLEASVD 759 Query: 421 FDVMKTENEDLQRKTKLLEEVTFSLKQK 504 +MK + ++L + +L E LKQ+ Sbjct: 760 IRIMKAKIDELGWQLELSTEAKEILKQR 787 >At1g04260.1 68414.m00417 prenylated rab acceptor (PRA1) family protein weak similarity to prenylated Rab acceptor [Mus musculus] GI:7716652; contains Pfam profile PF03208: Prenylated rab acceptor (PRA1) Length = 182 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 170 VTLFGIVVDDGAVADLLI 117 +T+FG +DDG VA LLI Sbjct: 96 LTIFGFTIDDGIVAVLLI 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.311 0.128 0.346 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,498,148 Number of Sequences: 28952 Number of extensions: 144491 Number of successful extensions: 691 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -